SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|175155 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|175155
Domain Number 1 Region: 231-352
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000234
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|175155
Sequence length 531
Sequence
MFPYVVAQLKKVRKRQPAKRQGLPTDCLIEEEMKSILKIWKGDVTESVLLLDKVIPKIPK
YKRGGIAGTVYNQSTFILPMLREAETIGSYKPPEKEITLESMLQDLLIDGYHMVFEEINN
LILIDAKERKEYEKLYGAHKAKPLHEQLDTIQFIAQFLKDAETAKNNDDFSLLFTCHLNL
ARTFAQGENSLAVRFFDLCMKIASEYPCDKDGSSLALSQLYFGLYAKSNDKNSSLIVASM
LNLGNFYTTKGDFTRALEILKECLQLCEEMMDWKGVASASQSIGAVFFKLDDLDKAKEYY
GRFIEVSDEGEDKHVLTESYLETGFAFNNAGHYNVAKEYVKKAFGSEITSEYETKARSLY
GIVHAHSMYSLYLPYVNRRSSYALETLLNWKDFRIDNFEEKPIRPKNEEKPILRREVVMK
KKIKQYDDIKDSSTTLPVFLSHIQPYNLEPKSVGSLRSDDVEDLVDYSLLNNNSFVKNAV
TTYAAHSGAQNIDLSAISLHVKANTQNKSLIELIQTQMNLERPHRDNRYES
Download sequence
Identical sequences T1F8X5
XP_009020837.1.102002 jgi|Helro1|175155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]