SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176502 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176502
Domain Number 1 Region: 43-77,224-392
Classification Level Classification E-value
Superfamily TPR-like 1.49e-24
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|176502
Domain Number - Region: 98-135
Classification Level Classification E-value
Superfamily DEATH domain 0.0942
Family DEATH domain, DD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176502
Sequence length 507
Sequence
MIFEQLQRLYEAKMYEDVKLLSILAVTITQKNPDQFNSTTRYQIFCYQGDAYYHTGEYHS
AINSYKNALQIRSFNKSKGKKSYTTQPMSLTALKGLISLGMNSSEVEQIISQSPGPHNNP
SIEWLSNWVQAQGLAKSLEYKSAASLLQSMDSQMTNIDVLAQSAEMYFLSGNYFKAISIR
ELNPLYYKKLDIYAFLLYQEQFKNTCLEKLASKTSMFPESAVEPWTINGYYNISFNKAPK
AIYLAQKALTIEPRNFEAVMMNGIALMVNADYQEALVKFREAIHISPTRYEPHYFVVEIY
WKTNRPKEAVACAIEYQRLAPSARSYTLHAVILLKDGSSISFEKARPILEKAIAIDPEHL
EAVLLLARVYENSNNCQAAINLLEQCSPKQPSLRYHKMMANLLIKLKNKMKALDHSITAK
RICILESQKNKFDEMLFACLPASCHFRLEPLVTKGSICKTSEIPLRFYLSSDEDTLDGEK
TNLGDFSLGILDGSFMNDVSDNLASFS
Download sequence
Identical sequences T1FAL3
jgi|Helro1|176502 XP_009022103.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]