SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177713 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|177713
Domain Number 1 Region: 1039-1124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-24
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 154-322
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000474
Family HAT/Suf repeat 0.011
Further Details:      
 
Domain Number 3 Region: 981-1035
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000057
Family Canonical RBD 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|177713
Domain Number - Region: 393-647
Classification Level Classification E-value
Superfamily TPR-like 0.000159
Family HAT/Suf repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177713
Sequence length 1155
Sequence
MSGFQYGYIYRHKTKRERERIREATAASVAPSSDGVIDDVEMREAGPGDTIRRGNDEQIQ
AAPNNHVDANDDEDDDQDSEDDNQDGEDEDQDDDDDDDDGGTGDNRHASAAADDEVHCGW
GEMEVEMEAERQRKLAEEEEMKQNILLKEAETLEDNVKSNLYNYEHHLNLITVLRKLKST
DALRAARERMSKIFPLTDKIWLEWFNDEMEANPDEINEYSEMHEISADEYHYRLSILKRA
VEDYDSVKLWMAMILFHSKVLPPTTDKEFKDEYEEMLNIDLMRKTFEEAIKRVGHHADAD
QLWTEYLDFEENVLHYLKLAHQSATDGEDTFATIRYSASVAAINAAAAAVATTTDATVAT
SPATAATTSVNLTPEAVAFAAEAAEASKERLNGIQEQKRIIKKVFLKIMSIPKMNLVHFN
LRYMRWCEGKRRTPPVDEAARERRGYSGFIESARRFVAAEMALLKAGIRKPKFDYEESEV
DRIADDELDFQLLDAFRSSFSLVGELCVHERKLEEKNTVENYEALINFLKLSSTGEYVRA
AYERLVIQDKDRDSMNKNKEGVSSNDDVNVTKDSEKDENLEYLLRTYRRSVRNCSWCVDL
WIGYIRTVEKIKLEHQNIKKIFNEALTVGFAQPYEYLNLWTAYIDYLRRRIDWSKGHESE
LEDLRDAFDNATNQLFQSFGMKGDPTCSLLQYRAFIENSQYNHCSNINLDLCIFDACIVL
MSGGDLRQFEEALLKCEAHLKRASERKKKTENASPKNKKNLNNSNSSNSNNKKSETNGKH
KQQQQPGCSNWRETQQQQQQQQSKLTPNQKFMEEVELLQEELRQQYGGKAAEAKRANTKS
NNNSNNKNNNNKNNNNNNNKRDGVRPYVRARPKVYVRGQIDTVIDNDGFRVPSLPPSLSS
SSSSLSSTSLSAPPSSLPTPPPSSSLPSSSSSSSAPPPGYNKKRGRGNDEDDGENVVADE
AAATASAAKRFKGMLEQSSSSSPQPSSSSSSSQPSSSSSQPQSSSSSAEEFTVFVSNLDF
SLGVEDIRNVFSEFSTSLEKNKLFIKNLSFETTKETLVALFEPIGQLKDVRLVTYHNGNS
KGLAFVEYADENLAAKALMKLDGYNLDGRAIAVSFSNPPQRNSPLALEGGNKTSWGYCQN
SVAAVAKKLEEGIHK
Download sequence
Identical sequences T1FC45
jgi|Helro1|177713 XP_009024121.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]