SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|181421 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|181421
Domain Number 1 Region: 739-787,814-867,894-927,958-1030,1098-1227,1306-1317
Classification Level Classification E-value
Superfamily TPR-like 4.84e-31
Family Tetratricopeptide repeat (TPR) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|181421
Sequence length 1612
Sequence
MANVNVKNVENVEVVRLRHTDLVDLTENMKNLQLNDKTSTTQPSPNVHSLDEVPRPLPKV
RKKNQRPDQCFYQPGKTKLQKPKQLQQQQRQSDNKDGDGVDLKATPTTATTATTTTNNKS
NDNSNCNNNNNNKSNDNDASSDKTVKHSPKKNSKRNTHRRNINCKNKNDDDDVGGDGVSG
GGSCGDDYGFLHNCDFEWDHMADLDANQSHHFVKVDDDDDDSNINNNNNNNNNNNNNNDD
DDCNNDCNYGHNIGDHNYNYGYDGGNINFNKMSKRYSAQRAKRISPSPSSSSSSPLFRPP
SSLSAAAAVAAATVATTTTAKTSAAFTSTAARTSSTTTTTFATSSKRVPYSNNNNNIDYN
RNNKKNNYTSNNNNNNNNNKKRNPSKTPMTVTKSPVAMTSLENFVPQSSLSLPPSTTTTT
AESLSSSSSSSRSVAVSSSSAAAATSEAAAVVKKGGLIKIPQNLLASLSLPSSSLSARTS
SASSSPSGRMNRISTTSTSTTTTTTNSGTAYYSYNTNDASSYNNGESTRDDSYDDDGGGG
GDDSSGRGRRRLRRLWDPEKDQIYPKCNGNIPINNNSNNGNDKLFKNIKANDLFDENKMR
PLSASHQQQQQQQQLRSSSALPPAQSSSSSSSSPPLKLLSSSPSPLKLLSASLPSASLPS
ASSSSSLATSYHEMMKFMDTLAKLMSHFESNYVSNNNNNNNNNNNNNNYNYFCANYNMIY
NDDGDDDDDDVGGDFGGKIWAEISILRRKVNLHLQRLISGDLVTCIKVSMLDKTWKSNHY
DVIQALFKMAATSCSSSNNNNNNNNNNNNNNNNNNNNNNNGSSNSNSIGVQILSLLNNVV
INSINYYESLLAIAEKFTQRANDNHATAAAAAAAATSTTTTTTTTTTNNNNNNNNNQRIK
TNDRLRTVASLACHKISIFLGDLERYKIQHNHHLNNNNNNNNTNNNNNKKNGNGSSINKF
DKSIMWYTKAIEYSPKYGKSYNQLAIISMHNRQYLDAVYCYIRNLGSRNPFSSVRQELQT
IFHNVFVKQQRLQQQQFNSKVNNNSKVKIDQRSLESLGRRVEIWVSVDGREDKVDEEEED
DEVDGEGNDNDDDEGEGERKNCQLSRSFTLHFMNVHGKLFTKIGMEAYEESARKMLLEFS
LLLKRGLRLQQQQQQQQLQQQQLSLMTTKLMKLLTVNIFSIDNYKDNEHLEELSVALAMD
MFVIICNYFLNIVNKLCNNNNSSSNNNSNNKSNKNNENNIINNNKINIINARNYFKSLFN
VDNSTTNNNSKNCDIISSCSGSDSSNDYDVIVDDNKNALALINTYLSYIKIWYDWMGRNI
GKCVKPLKSLLPSSSSSSSSSSSLSSSSSSSSSSSFPSPVLHLNSVWLCVVEIANIVLAL
NFDSLVSSRRHHHHHFASTSLSLPPELSSSSSPSSSDSNTTIDDNNNNNNNYKSNNNNRM
MTSSGSNLFTKVRLYEDDFFNGYLPLRGNSYGVVERIMTSAAMTSLSGNDDNDAEEDGDD
GDGGGEIYVPGAFCKEIQMMIARLSRIKQSSTRMLATMTKMKMVQYDSDNNNNNNNNNNN
NSNNNNNNNNSNGNGHDRSIPPSWLPTPTATSIISLESKTYSPLRDIHSFCH
Download sequence
Identical sequences T1FGZ8
XP_009029478.1.102002 jgi|Helro1|181421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]