SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182125 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182125
Domain Number 1 Region: 28-303
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-43
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182125
Sequence length 311
Sequence
MVLDVVESGLSYLNSGLNETAYEYRNDAFTSNREYVYHYETQVMSAIKTASRQLTGLKIR
SQVHLFFQNQMAYIKLQNIKVFELDEVIPASQQHGFLPEYLLRPVPYEVEKSIMAELTKP
IKFQYDQGAVIDIFHASDDSDWSINIKKGVISALQLRVANKWQQSGSSLVSSAERSTDTK
SPVKVFETVETDVLGKCTSTYAIYHSTGRLPDPFQASLPSNDAVVRKVRDSAGCIKVYGK
PVGLYAGLPHLAEEKDLIDGSVTVESHISGNLENFLIKKVEVKGKYHFTPYVEEGGHVST
QVLLVIHSFIR
Download sequence
Identical sequences T1FHS9
jgi|Helro1|182125 XP_009030670.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]