SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188177 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188177
Domain Number 1 Region: 51-327
Classification Level Classification E-value
Superfamily TPR-like 1.43e-29
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188177
Domain Number - Region: 351-400
Classification Level Classification E-value
Superfamily TPR-like 0.000346
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188177
Sequence length 433
Sequence
MSKRDLFAGSGDQLNWLLHLNFVRKDYDKCRNLLRVDHERQCQNEYGSYVLGLVARIDGD
INESLKHFQTASAINCKNVANFKQIAKSLFLLARHKAALDVYSEAEKLCHNDWELTHNKA
LCYMYLKDLNKAKEVLNEAIQYKDSHLSHSLLGEIYQSEMNINKSIAAYTKALAVFPENV
DISCTLGLLYLQMGDYKNAFSHLGNAMTYDPDNVKAIMGAGSMLQMHGDHDVALAKYKLA
VRYIPNSGPLWNNIGMCYFNKKKLVAAVSCLKRAHYFCPLERTISQNLVLIYLYSQQYAS
AFNFITSAMFLRFKSALHYFLLAVLYELIKMADKLHHYRYIVLTKQIRTVTLSHLKDREN
SKQAFKQALQLDDKDALISLNFSIFLFNNGDHKSASEQYNSYKSKLQHKNYENDSEVREA
SEKLCSALHLGSV
Download sequence
Identical sequences T1FPQ8
XP_009009955.1.102002 jgi|Helro1|188177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]