SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191433 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|191433
Domain Number 1 Region: 52-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 99-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000641
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191433
Sequence length 831
Sequence
MDPSLANNRQMNLEHSQPTKENVDDVTGDDSDSNNINNNYDDPDNDNYDDSECTDSDFHC
SSKNECVSMPFVCNGIPECTDGSDEVNCTAGSATSLPGCPPHFSECSADVNGAACITADM
FCDGKVHCPDGLDEVKEYCSKVEQASSGSTNRNISVMVGIISAILLVLIIIVVVVVYIIL
SKKRHKRCHSRRRTLPPPTMTSIATIFNSSDAHNDQHQSKQQQQLAQQQQQQQQPRNNMA
YNDESLRYDPSDNLPPPYNKIIQQQQQQQLLLQQQASSTSSFERLDMGAIDYDPKSKELP
ISNQTSSPFFSSSSSPLHNKKVASSATNNHGGRSRKNDNMVSYRSSKSSVGDHIYEEPTG
VVSMMKERNNAAAAAAAEDDDDDGVVSRYPCADEEDEDEEEDDNVHQVLNSRFSPMHLQS
IQKQHLLHHQQQQQDQYYKPQQQQHQQQQQQQRNMRSSVVSPNAASATCQRVSRIRLGTA
VIQQRNDNSWVDNGLCTANPSTNNYLDNRGHATMGRSSRRNNSNQLQHASVMSSRRRSGG
LDGVFNSPPTTPPHHYADQFYPTSDNHNQQHSRYRNNNGPADDVMTALRLASKNSSSAES
SNNSSNSASSNTKLLPSSASCQQFQPNILQNNNAVRRDPKSTSSKTSQVDRIPLGICFST
DQQQMSEMFSQQYDRYQQQQQQIQQLQQQIQQQHIQPIRKQSTTPASLTHNNSFQQRQHI
LGRESSIGGTRPDRETNNANKLNFSQYSNIDNISNNIRLQNFTQIDCDKTKLGSPFANEH
VALSKCMPQNIEQPLNQRFHDDEQLKFAKLLNHRSTSEILCGDEFLNPTCV
Download sequence
Identical sequences T1FSZ2
XP_009016589.1.102002 jgi|Helro1|191433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]