SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|193731 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|193731
Domain Number 1 Region: 285-780
Classification Level Classification E-value
Superfamily TPR-like 0.000019
Family HAT/Suf repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|193731
Sequence length 1215
Sequence
MSLFPCFDELQQRKESAVHSDKNSNESCSKTGEVWCATTSNIATHRDGGHKNGGGDGGGG
KSGAFRKNIDHKKKKEKKRQKMLSDDSSDYDDDDGGDPPNKRHKNSKIAGGMNESQSKSS
SLDRLPISLSPIPSSSSSSSKPALSSERQSSQLTDDEHEFFIDVKPDRENTLYEGNYRVP
TYKNIFNLHDHHTSPSTNNNSKSETNERYFSVARQLKQLNISKGLDAVVLPPSSSTSTSS
PSSTIKMELAHKHDSAGATSTTNINTNNHSADDATIELQTRSFNEKLRKDPRNSQLWIEF
VHFQDKKFMHDMNLSTLNARSNNDLQLLSDIKLSILDEAIKYHPHHHKLILLRQQIRESA
WSKEDVISSWNQLINTHERDAKLWSSYIRYMKSKMKSFDEVLDAYKKCFTHLKHTGQVTQ
LINLLREASNFIMQAGQSELSISVYQLLIDMNLTAPKSIKSLSLDDQLDFLNAYWSAGAA
RLGEPHWVGWGVWVDKRGEVQQQQQIGIHGKSEEEVELEILSANQNNRPTCWSQLELSRS
RRHWFPWRPTNDEDECEDDERMVTFDDLTQFLFKIKTNKRNDDGDDGVGGESHEENDDDY
NMFILFIDFLNMMMKRSGRYDGDEAECNDECDEDDDDAAAADDDYLKNILLSGDVIKRHN
HLTKLNFKLDRESDNDEDVDDDNNAEGGYNGEGFENVDDMIENLMLLGTKQFKNEFKRIF
LHKYVYYKFNSLKIRGTAEKDCRKFFKSLLKENSDDVLLWMKYASFEYSCGNVELAWKVI
STTRASNYNNSCKIVLERYNFDFISGYMEESAPKYKVGSSGVKTRPGVNTNLKAADVNAE
KVVESLSWVLATSTSTGINSTLSDSLATLTKSDEKLCNNISRTSSTLLNIVEDAIVNMNV
NANRNNNSNNKIHLSSYCLHHLGHDLLHLVHLLVRFIAITADIQVAVQIHDRVLDFLLHQ
TPANTATNDSNNNSRTTNDRGNDSNSKKKISSYDNMLQKFKSSLARYMIYDLWELINFYL
SNHFLQQTLLIATATKHLKLFPKSLNIIRNYMMHRNENNVMACINDGLDISDLLYGGRPL
LALRVAYLASLFSLYCRNNGRKSAENRMINFMTFCMNDEQTAKSSMLWYLCFLIQASVSK
GKMIDIFYRATEHHPFLKKLYMLAIRYIPEKFVTIATLMANKKIRVRTYTEEVDLLMKCF
QIVSASKQMNAGDDN
Download sequence
Identical sequences T1FVA9
jgi|Helro1|193731 XP_009026943.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]