SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|77344 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|77344
Domain Number 1 Region: 696-904
Classification Level Classification E-value
Superfamily TPR-like 1.31e-29
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 494-699
Classification Level Classification E-value
Superfamily TPR-like 7.4e-25
Family Transcription factor MalT domain III 0.066
Further Details:      
 
Domain Number 3 Region: 405-488
Classification Level Classification E-value
Superfamily TPR-like 0.00000000759
Family Tetratricopeptide repeat (TPR) 0.068
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|77344
Domain Number - Region: 356-408
Classification Level Classification E-value
Superfamily TPR-like 0.000632
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number - Region: 282-345
Classification Level Classification E-value
Superfamily TPR-like 0.0011
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|77344
Sequence length 933
Sequence
MAAVQSLVDKKKKTFIGLAAPLGYVPGLGRGATGFTTRSDIGPARDADDIPEERHAPPSK
KKKDDEEEEEDLNDANYDEFEGYGGSICARDPYDKDDEEADEIYFSIDSRMDEKRKERRE
KRMKEELEKYRQERPKIQQQFSDLKRELSGVTLDEWTNLPEIGDARNKRMRNPRAERFTP
MPDSVLSKNVHMGDTTTAVDLREQRFGGLTSPFPGSNTPASMLASMGSDIDMKKIGEARN
ALMDIKLTQVSDSVSGQTVVDPKGYLTDLQSMIPTRGADISDVKKARLLLKSVRETNPKH
PPAWIASATLEEVTGKLQAARNLIMSGCEQCPKSENLWMEAIRLMPGDQARVVVAQAVRH
LPQSVSIWMKAASLESNSNDKKIIFRKALENIPNSVALWKAAVELEDEEDARILLSRAVE
CCPSNVELWLALSRLETYENAKAVLNRARNQIPTDRQIWITAAKLEEANGNFSMVPKIIE
KALTSLRASGVEINREQWLKDAEDAEKSHSVHTCRAIINNIIGIGMEDEEKKEAWMTDAD
SCAVHGAIECARAIYTHSLSVFPNKKNIWLAAAAFEKDYGSRESYELLLQKAVTHCPKVE
VLWLMGAKSKWLAGDVSAARSILSLAFQANPNAEVIWLAAVKLESENNEFERARRLLQRA
RSNASTARVFLKSVKLEWCLGDIAKARILLQESVDLYPSFAKLWMMKGQIEEQEGNIEDV
REIYKQGIQKCPESIPLWLLLSRVEEKAGLLIKARAVLEKARLKNPKNADLWLEAVKLEN
RAGLKSIALNLMAKALQECPDSGKLWAEAIFMEPRPQRKTKSADALKKCQHNAYVLLAAA
KLIWSERKLDKAREWFKRTVKLDGDLGDAWAHFYKFELIHGSEVQQEEVKRQCLSAEPKH
GELWCKVSKDIKNWRLKTEDILPLVAQLVPIPS
Download sequence
Identical sequences T1G2W5
jgi|Helro1|77344 XP_009016422.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]