SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|78021 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|78021
Domain Number 1 Region: 458-565
Classification Level Classification E-value
Superfamily TPR-like 9.97e-24
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|78021
Sequence length 606
Sequence
SRAIKKNPDVLGETSVWSLLKNDFWGTPLTHSGSHKSYRPLCTLTFRLNHNISGLNPIGF
HSFNIILHCLTTALYAKTIKKLMTSSRLTMLAGLMFASHPVHTEAVSGIVGRADVLSCFF
FLLAFNFYISYCQTRQARQTRWKNNASTVCSLKDKEQGVTVVPVCFAYDIFLHQKLKFSQ
LFAFKRKNVNWTLIRSILLNMLTLLFMVTFRMLVIGMKFPEFSASDNPAADSDDLLTRTL
TFLYLPVFNFMMLMYPWQLSFDWSMDAIQLIESYSDPRNILTLTFYSCLIFTLYYILKNV
NVKNERSLVSTCNGTQRHASLHEPTRHKTFHTRQRNHSNVSGCVTFCDVGHKTKIPVEQH
VYFVMALSLLIFPYIPASNLFFYVGFVVAERVLYMPSLGYCLLFALIVEYLLLLVERTAD
RKLRKMIIYAFVLTMLATFCLKTLKRNEDWLTEEALYRAGIQVNPAKAWGNLANVLNGQG
RAEEAERAYKTALLHRSNMADVHYNLGILYQEQKRYMEAKKSYEMAIQCRPKLTMAHLNL
GIIMTTLGKFKEAEQVYRHCSEIDTYGLKDPRLHEQTKISALYNLGRLLADQERHQVNRM
MMMMMW
Download sequence
Identical sequences T1G368
jgi|Helro1|78021 XP_009016571.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]