SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|81357 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|81357
Domain Number 1 Region: 26-346
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 3.14e-26
Family Tricorn protease domain 2 0.054
Further Details:      
 
Domain Number 2 Region: 272-582
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000531
Family WD40-repeat 0.038
Further Details:      
 
Domain Number 3 Region: 777-944
Classification Level Classification E-value
Superfamily TPR-like 0.0000948
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|81357
Sequence length 1342
Sequence
LKKIFTISPKRPEREAIYFSWQKCYGNYIATNSADSCVQIHNKRGDLVEELNMPGICTGF
AWMKDGSILSLINNKNGVIWLWSASKNDVTFVESGFRDKDTLTFSLWSKISQHLAVGTLK
GNLLIYNHQTTKKIPILGKHTKRIVTGAWNKENILALGGDDKVLTVSNTDGDTINSVAVD
GEIRDVQFSSMKRDERVDAENTVSLVKNRKSLYLYDITDAHQPLEIKFKDSYGDIVAYNW
HGDGYIIMGFSNGFFIIVSSHYKEIGQEICQVRDFRDYLSFISVSSSINIIATAGDDSVK
LHETNDPKQTASIIQIADQSKLERIKWSDDGQLLAVSSSSPTPRVHVYLASVPVLGACFR
TTVAHLTSLREITLENPADGGQSRTYMVEVEPSFIGLGANHLAVGMNNTVLFYGFKKNAL
VKVEEKEYLSSIQSIKLNDKYVSAHSDGKLVLSLVSSFFSIDQQQQQQQQQQQQQQAKIT
SHHLTTDFLIYTTDKGTINYFHLADWCPILEYHHICHVTKSQPDVSGGRVVLVDEKGDCA
LYHAFFDSILPIHDTPQKVAGVLWDEWSHDKNIFIIYDRDSIHTYCHLRETLKGPQVILA
GTTKLPYNHQPILLLAGNLTLLTPSGSTTDLYLSSHPNYNNNNNNIIHNNHNNNYNYGGF
GDAYFACQLLNNSEMWEELARSAINSLDVEIAMKACQAEGNIGNALALQNLLLMEDKQLL
TGYLCMLIGDFDAAQEMFIHSVRPMAALEMRRDLMHWDQALELSKSLDQGQLHLISKEYA
QQLEFVGDYANSLKHYQQGITKDPEQQEHDEACRAGVARMMIRNGDINKGMTVAIKMGSK
NVLKECAIILESMKQYSESGSLFERACLYDRAATVYIKAKNWSKVGEIRPQVTLTKVHSQ
YARAREAGGSFKEAARAYEDAKDWCNAIRMNLEHLKNPEEAIRIVKMSNSLEGAKMVSKF
FENLKDYSTAIQFLVLSKCNDDAFRLAQKHGHMTKYADIIGDDAKQDDYKSIAVHFENEN
NHFLAGKFYFLAGYYNKAINHLLDPSLKSRDDAINMAVDVAGQSNDQQIFKRLIGYLMGD
QDDEPKDPKFLFRLYMVQKKYKEASSIAIIIAREEQNNGTYRTAHTLLFDMSNELRKNKL
RVPQEMLHNLMLLHSYILVKILIKMGDHLKAARMLIRVANNISKFPSHVVPILTSTIIEC
QRSGLKLSAFTYASMLMRPDYRDKLDPKYKKKIEGIVRWPEKIELDPQLSECPFCGFNLS
ETELTCSACKNNIPFCIASGHHVVKDQTTVCPSCNFPAIIEELLRVLKSEDSACPMCGDK
VDPLDVQKPMEMNKILQFLETD
Download sequence
Identical sequences T1G4D6
jgi|Helro1|81357 XP_009020224.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]