SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|83856 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|83856
Domain Number 1 Region: 144-235,349-417
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000124
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|83856
Sequence length 497
Sequence
TTEEAHAELCYAELLLQQAFLTFIQDENFVSFIKGAFKVKTCLNSYKESVEIMKKRSWKE
NEGLEDFKTGICMGVGAFNLMISLLPPRILKVLEFVGYRGSKEKGLRELETGAMLSDTLR
SPICSVLLIQYHIIISYIFGLGDGDTELSSRLLDTMQAKCPNSAIFHFLRGRIYEVSGDI
DRAIMTFEESIDSQDQWKQLHHFCCWELMWCHSYLGNWLLAMKYAEKLFEESKWSKSMYA
YLKGTFMMMMMMKTTTMMTMMVPRLKQRIAGKSVPVEKWAVMKVQMYYEQSEFLMLPAYE
VMYVWNGFEVMGKREELIVSVISVIEEALRNLTMTSEDDAPNIMKFDNACLLNLLLGVCF
RLIGQFDSAEKCFAFVIDNKKNVQRDTYLVPSCMYERGLLFMQMMKFKEAERSFDDARLV
SMYVYLSHSLSLFLSLSLSLSLSFSFFLYIFFSFFLFLSMFLFLLSLSTCVCVCVCLRVC
VPACVCMCVFQVSSNHN
Download sequence
Identical sequences T1G5B1
jgi|Helro1|83856 XP_009022030.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]