SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|96415 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|96415
Domain Number 1 Region: 3-328,485-515
Classification Level Classification E-value
Superfamily TPR-like 8.22e-62
Family Tetratricopeptide repeat (TPR) 0.000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|96415
Sequence length 518
Sequence
MSSIDLFKQAENLKLACNDTTKGPNEVWKSRQLLQEIYQTLLTTDLEFALDKKVEQDLWK
YTFKKQISSLQCQGKDNKQGNLRKGEVQAGLNLFLKAASGFYLQLLQELTCWWKMDTPFN
KQPYCIGIIKEYPPIRTSKKFAHLNSYMYICQDCLVHLGDISRYRDLIDQAQFYYKHAAR
LAPFNGQPYNQLAILEVQRGNKLSAVFYHMRGLALIHPFPVSEVNLMKFFNKISKDSYES
RQKLASNEWISFFLQFHATIFLNLDLNKSEIRLNKILSTFNNNLESTSGFSGLQLIQICA
INFYQCYCLAKRVATKSNDKKNAFNINQSGDSKKVSDVTGRSGCETDVTGRSGCQDHLVG
NDGDESRTLKVLLSEDARGCSGSTDGEVRSNRWGLEGEVEDMIDDSFVFDEVRNIPHHGD
HLDSTAHKERCVDARDVQYKKQLIMVTDLTVAILNQMLEKCCEAATTNEQNGCSEFNDFA
LETVFPSVKSCLEWLVINLEMLHDCTNVQTVGLWSANC
Download sequence
Identical sequences T1G9B9
XP_009030567.1.102002 jgi|Helro1|96415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]