SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 14.m00270 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  14.m00270
Domain Number 1 Region: 459-658
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-45
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 346-491
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.84e-20
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Weak hits

Sequence:  14.m00270
Domain Number - Region: 891-988
Classification Level Classification E-value
Superfamily Tlp20, baculovirus telokin-like protein 0.0157
Family Tlp20, baculovirus telokin-like protein 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 14.m00270
Sequence length 1126
Comment cation channel family protein
Sequence
MSQDRGVSYLNNLNYRENILLNEEDHKFFQAFPYKQRDSEVQSVSYSQTSRRDLSANNEE
KIQENTQDNTILQAIDEAQRQQYHSVLQQQENSIKYFQKQTLKKLQTQKLVIINTDVNIK
DLAYKNEQTSKLMNILKLLVNIQHFFRILSMNSRIFNKLTQHQHYLISDISSSYTKNFNL
KKGNNKFNIFNNSLYFLIDLIHKLDKYVFTPQNNLIKAWDTLQSLLIIFSTFLLNLELFF
GMNISNFQLLFQVIFIVSIIDILVGFNTGVLKKGNIITERNFIIKSYIKNRLFFSLIGNI
PLFFYISKVEVSTTMRILVNIFYAFKWNKVSDVLKQIAFYVSYEKDHKNIFDLLKLLIFV
IGICHIFCLFWHGLVMFEINNGITNNWLESKNLLNASIQERYIYSFYFLAVTMATVGYGD
ISPQNQFEVLFTTVTIFVTCIVYAFSLNTIGAIIENIEKKDKKYKENLQIIHALMREEEV
SRNLKIKISDYIKYLYKESNEIQRKQEKLIIEKLSAKLRNDLNLEIQGKYLSNIPLFKYF
KEKDKVAKIMEEQLYSPSEIIFTQGDIDDCSLYYIVKGSVSIIFESGQNLNREAIQIELK
QNKQYFGEISFITGNPRTYTAKATDFCKIFKINRQSFLSVIKEHDQDYENFQMIKEAITF
NYYFQIQQQLTTRKSFIQQETYQEKLFTKKNAVLQINNVESLSEIIDFIENGSYYQDQFD
NEANYKQEIQLGSERGIRLRNNTHSSNFISTKNDNFGSQLDTIRKAQKSMENQQEKTIDY
LKIQRKSYLNQQNNQQLNVDQNNQTQKQTKKSFLYSASQNQQFIQELQKCEQVDIKQNSS
MNNDELQPQSQPSISSLTSQNERNDSIDSSLSIENKIENNPKQKKSFLIPNYLEDKQNQN
QITFEQKDEQLLQKRLSQISQRRQSNKNKTIKLINNSSKNIILNNDDQQLQYNRYFVDKQ
KNNNQQNDRSINLILLAKEPNQLENNQTTIQFNTSKITEGQITKFNNFQIPAELLTLKQF
QQLSSNYSLQNLSQLSLKNSQNQYSLQNEQKVNQGTNSQSSGQFSKHNQIGILQSDKKID
DITESSDQVNYLMLQIFDKAKIYKYYQPHFNYTEIQNIYLSFLKKN
Download sequence
Identical sequences 5911.XP_001008652 14.m00270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]