SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 14.m00272 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  14.m00272
Domain Number 1 Region: 330-515
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.09e-42
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 194-212,263-362
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-18
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 14.m00272
Sequence length 986
Comment cyclic nucleotide-binding domain containing protein
Sequence
MIKKKDNKLPFKQSDSEVEPGSFFESSRIYSTTKNEIPQQENIQNKTILQVLSEYQRDQF
QECTSVYTEKSFSRNTKTLTNNSPIKHNQLTQSQKYDIQNINLNQEEFQFKKAEPIRLMR
TLKLIVNIQQFFRILSMNARIFNRLTQHQHNLIGDASSVYSKSLSLKNGGKVFNLVNNFM
YISLKLRFVRQYTSLFLYFESRSFYFYENIYQYFVYFQVGQNFESIIADSFLRICHIFCL
FWHGLVLLEINNGITNNWLASKNLLDASIQDRYIYSFYFLAVTMATVGYGDIAPQNKLEV
LFTTITIFVTCVVYAFSLNTIGGIIENIEKKDKKYKENLQIIHGLMREEEVSRELKIQVS
NYIEYLYKESNEIQKKQEKLIIQKLSTKLRNDLTLEIQGKYLSNIPLFKSIQEKDQIAKI
MEEQLYSPAETIFTQGDIDDCSLYYIVKGSVSIVFESGQNSNREAQQIQLKQKKEYFGEI
SFITGNRRTFTAKATDFCRIYKINREQFLSIQQQMLIRKNLIYKETAQVKLLQKNIAINQ
INNNESLFEILDTIEFESVQFDLLDGEINYQQQIENEDDRDLFQRGNTIFLNQIPVQNEV
NRKRSETLSRIFITLDNHQQQQSFSQIPIQTRKYSILNQNKIQINQKKSIDQIIQQQKQP
RKSIHYRASQNQQLIQDEQINEINNTENQYQTNTMQKQNSNNLKDLSQLTPSISSSSSHS
SSSSSSSSDEIDDNIKNFIIKCKSIKSQEKINSSDKQNQNLGLNDQLENKQIQILTKQVI
DQQKDTLQHNQNHYRKNSLYINDLNDHNNPNNNNNNNNNQQQQNGILLNNRARRLTRQNL
KLENLISFIESNNSSFEEDIKANKRKSFQITNGIMNFKQISPNNSLKTININNQANYSNN
MCTPFQYQGEQQNFLNFEKKFLEASESQDQVNYFMLQVFDKAKIFKYYFPNYNYPEVLQK
WMIFQSKKQKSIPISILAKNKYKIMY
Download sequence
Identical sequences 14.m00272 5911.XP_001008654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]