SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 14.m00383 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  14.m00383
Domain Number 1 Region: 652-854
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.73e-33
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 530-687
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000275
Family Voltage-gated potassium channels 0.0089
Further Details:      
 
Weak hits

Sequence:  14.m00383
Domain Number - Region: 867-889
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0205
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 14.m00383
Sequence length 1345
Comment cation channel family protein
Sequence
MNNIVLHPYSLNSSVNQNTLREDSPVKIVNHIPSLQNLILKEVKENQQSLPVLSQQAYSQ
PNNNYAGNSPANYGSQLQVGNKRFGSSYEVVNSMSNPFSTPELDDNIRLTNPQNNNYVGS
NNYSQMHRDSLSLNLQQNNLSTIKVKSYTGSYISNTSSSIALQGILKKQYEGAREGQDQR
MKLFTFNEDLAHMNQGKLDMEQSPIAPDNISLSEKAPVSSLLNNNVLPGGQQQQLQNSIN
LQQQQYQQQQQQQFGILTATNRRKESVNQGTYKTATIAYTQYKQRQKRWKEKWMVMSYFI
SKSIQNFKKILILSKPAYLTKLQLNLINDKSSHYDKVRENKEKRYQGWLYDSQGCCSRRN
KKRILILLKKIRGIKNFVLNTLKILEQKINDFDQKLTPFSPLNTFLQFFEFLILIFTLFI
GICIPFYICFQDEIVDTPTGDSLKIIIKHVAPYVFIFDILKYLNTGCFIRGQIINDRLQI
FQNYMRERFICDSISIIALFIFDSDPIFPNNFTLIFFYFRFYFGLHVIGKIRESFLLKDK
THALINILVIVFFITFFAHVFACLWYYIGMHQGDDLKQSWIQQTQVKNDSLDVKYLDSLY
YAFTAISTLNTSISPQTKYEKLFLILITFCTYGILGLILYESQQILENLSLKKKNYLRQL
KQITRYMSDHNVSEHYQSLARKYLQYVTNEGLDSRQVSADKSLQGLSLQLKEDIIKDAFM
NQLKGIRVFSRYFSQQFLEKLAMKMGEQILGPDEYVINANKLQSPKIYIVKKGLIEFFVN
IGTQRTNIKDSLKSFKIFKENDYFGSYEFFSDSYKPHLSARSIGVSVVQFISLTDFLELL
HEFPEEREAYSYIKEMVTIYKQLDIIGITCYSCGERDHQTLNCPYLFYDQQRANILKRID
QETHFQVRQYKRKKLKKYNCLKECKKIWHDQDKFIIDNADELQSQSSMKSLEVEDNLQLN
NIDLPKMDSQYLDSYFHMRGKTSSIGTFGTLRVREDQPPGNINNIYFDSDLDVHSVNSHL
KSNATKTVNEHEWNVNNNSLNSINQLQSNTNAMMLNQPINLNPLIPKTPSLQSAIEEEDQ
TNFNTRKMLSKLTSSPSRQSMNIPTTKLPDLKYRSKSTHIKPSVGDSFVEEASSLIDIKS
LGTAKSPRPNTVVVPAQKSESQPSLMRRNTTKTRNRVQSFNLDTTQYRDNTSPWREGTHR
SQRKQYEQSIFSQLQDNKSNNIEEEESSYTDEEDEIQKEMASQKSFSYKDLARSDKQSKP
SEKQQGIPYYSENIYTYQYIQNNFSTVHSFRTFFPHNNVENVIEYINKKNRGNKRVRSKK
FTKKLSHRSIKKQSSLRSKKLKIDI
Download sequence
Identical sequences Q22TB8
14.m00383 XP_001008765.1.55412 5911.XP_001008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]