SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 16.m00437 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  16.m00437
Domain Number 1 Region: 358-566
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-49
Family cAMP-binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 243-398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-20
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 16.m00437
Sequence length 1304
Comment cyclic nucleotide-binding domain containing protein
Sequence
MNEKQTDFSKNKSFKSAVFGGDKQPNSSIIQSKDGQSHRVHQFQKIQNQSDMQSFIIRGC
NSHLENSSPFIASGEKQDIQIKERGKFEQLIFNIKLKFYAMKLLNQTRSRMFQNLTSRQF
KLIDDISCDQNLIVNRQIEKRRLQKSKLLNQNINDSSILKKSFLRQNTHNQNIYQQLVDT
QFFSECLKQLDSIIKVLDPNSLMKIMMDSLSFSRYYDLLLLSFIWKIKNYLYTLGKLEEI
SFFTKKQKNIITLIKLIFTLMMIAHILSCLWIFLAESLQHRNIQTWLKSSEVNVTPWHEI
YINSYYFTVVTMVTVGYGDVIPISYEEKTVSILFMLFLCGIFGYSMNTVGSIIQSLNEDH
AQIRQNMSIINQFMNRTKVSKKTQNAIREYLEYYWSEQRDKNHKQEEQIFEILPENLRQN
LLMEGKGIVLKQTAIFRDNFSDAFKQKIVPLIQERHYIPQQLICEQGELDDCDIYFIEKG
SVNILLDSYAYEGTPSIPKIDPKQIITLTAGQSFGEISFFTGQPRTAYVKSKEFTTLQII
KRQEFMNELQNFQKDFEQFCNIKDNISIYSDFQLIDLKCLSCQSLNHQLLQCPYVHFLPN
HAKLRAQFMSSPPQERVFKNRKLKEKLKSIQLVKKNSTFINRLIEYDTEIEYYFQTYLER
ESGSEDESKSEHENSSTKQFIDDQNGNQFQFSQFNNIEDLQKRDSNIQSLQQATSQLSQK
MIIAEVKQKNMYNDISPTKQSEEIDLFGNQIHRTPSSQVNKGKSRHASYVNKEDEDSLNL
QKSRLGSSSYRIESSLGENRKQHIEENFVKPKGKQYYDDIHQGENTDQNQYIQAQIPFAV
SQKCLPAYKNSQLKIQKLQDPLSLALQKYQTMLNKILQIFQDMAPNALPQQHELQSPSIK
KHFSTNKIQNNVSSKNELQKKNSFNRKQEPKSNLMYKNQSSISNSKAIVSKRSIGRYVPE
QDSKQTSNINQSNQFQTKDTNFYLDETNNVQYIQSNQDIQREFYEEFDFDIMKNFEYYFP
LNNFEHQMKLMRLNIEQRRKKMLRAHIENMNILKKNKSLAISFHKGKRNSLSSSQNLYTL
NRQQNNNDDKEDQSKYKFKAQRESSLFLGDSQKKYDSLSLHQGKKGPQFNLNNLSFNNQI
DISQINQKSNKNYKESILNQTNLEFQHIKLNQKNNDIIHNNFDDSFQDKENDIFDGSMNI
QDQQINIKKIISDEVMKRVESFNSDLNESNNKEQVFSQKNSFQKQQIKNSLKGFRQYSQD
DKQRGSNSKRHLELEIESQTEYSQNRRNINTNDILIGMQNKTKL
Download sequence
Identical sequences 5911.XP_001017250 16.m00437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]