SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 22.m00262 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  22.m00262
Domain Number 1 Region: 232-342
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-23
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 325-490
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-20
Family cAMP-binding domain 0.0085
Further Details:      
 
Weak hits

Sequence:  22.m00262
Domain Number - Region: 499-520
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0497
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 22.m00262
Sequence length 743
Comment hypothetical protein
Sequence
MLQNQHLSYDNLISCQLSKSLNDECKIFENSLSQITSTTKNPFIKVKQVSVVDILKGDDL
DSIQSQSRITQSNLHQISQNCFQCEQNHDLDSSASQDSQQFSKTIHEGNNYKIENDHEIQ
VDLSYSDDNQKEQQTKNEISRELKKKKQNQLDGLVEQLVKKKRKNNIELGYINSKNIWKK
KWLGVLFYVSKFLYIAKQCQKVFRASLLTSFQLHLIGDISSDFEQNECYRSLFYGHLFAC
IWYYVGNQSEQGWIAFNQLDRSDIYSNYVCSYYYAVVTMTTIGYGDITAKTTGERSVMIF
LALLSCGIFGFTINSIGNILSDFKQKSDTYLTELGKLNKYLSFYQVSSEVQINARKYLKF
IHQEKHNNQLSSFQSLNNLSGDLQNQIKMEVISKQLKQIQLFRNILKEEIILQLSLQVQE
NIYQPEQIILGQNEVKEPTIYIINHGRVLKYSQYDLASKENSIVLSTFLKIIKQDNESYE
KFCYVKDQVIYQQYLSQINYSCLSCQSKSHTLKDCPSIFYNKRYVSIIKKYLQPEQQQKQ
QQDDNKKRKAKKKQNCWKLFDQNYSQAIDFQNNNINQLSFDECSQITEEDDQEESNINDN
NKDCIQEFNLVETETRKSIFTQNLLKLSEDRDHFNSHKTGDILNEDDCSIGNIGSELKPQ
IIIQSRKHNTYDFQKSEEMKKQSSNSIEQQQQQQEDDLFWQFQCNLVIDLEFKRCSDVSI
IKLNFTKDAIKINQFLQGELQKT
Download sequence
Identical sequences 5911.XP_001019086 22.m00262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]