SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3677.m00021 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3677.m00021
Domain Number 1 Region: 599-759
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.1e-33
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 370-597
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Weak hits

Sequence:  3677.m00021
Domain Number - Region: 766-785
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.016
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3677.m00021
Sequence length 1199
Comment cation channel family protein
Sequence
MEENHSKNQKSKQQSSNQINSIINNFHQLPHQDQKNNISLKQIYVDQGRHSSNLNSPKIQ
KEYKMIDNEENYVSVISLNERQDLSDISQYLTRSQQDLFYYTSDRTAVSGIQPLNSTIYP
KINLYGKQEENSKFEHFNDEQISVRQSFFQNADNKDVQNRLSISFGANSEVQNENFNNTE
KRLSKSKKNNPSFNSDKKNDRRRSSNLQLQQQMLKFEQSLQKIIQDKSNKQIELKDDEVS
REVSDLEMSQRLQKKTTLQQSQDSAQNGDLHQNTLNIQKLKKKEEKMRNQFVIRVKHFQR
FLKNMKNLSQSFKFRTMSLDQKQKFNDLSFFQSKKKQLTMAIDGQQIISKAFSKVFSKLI
NFIPVFNPLNSAIIIFELVVIVILVTQMLVLPLADSFDIDFFEIRVCQIIFYTIPAIIFT
VAVFIKLNTGFFKENIVVSNRKKILRNYYKTGGLVIDIITIFSIIITQFTQNSYVYIFFL
IRLYQIQNSLSKVDTKFSLSQRVPHSFEILKLVFLVLMLAHMNGCIFNYVAKNLDESWIT
KNNLKNSDWYVRYINSVYFSFITMVTVGYGDITPVSLQEKVFVIFMVVYSCGAFGYIYLH
YLEQMDHYNHQKGEQIVQKLSPYLQSQINMNSYYPFLNKTNIFKLNFKNSILVNSSLKMK
ELTFGPGQIIFNENDCDNRIFYILKGEVQLSYNNHNICVKDENDNCFGISEFFSGEARSL
QAKSKTVSQILYLELNQFIEVLKEDPLEYEKFCCIKEQITESRTVVDQACYFCKQFNHAY
DKCPFFTIKNQRQLFIERSKISINQTRQQHYRKKKLKFSSVVENGQVRLHLKAIRLNYIN
NQVIDKHQMIQLVANTIQMETDFDFYKKYDAFYLKCIDDQEFQTVLVPFDKIFEEFYTED
ESCDDEQEVNDNLNPGTNMQKKLSRSSIQGSDNFLEEQKISSQTSIVSSPNQQPKKSLHQ
ITQMVTQNSSNINSNSTVMNDKASIFKDTITTMMSKKTTFPRQQTTKRLSNLSHCQNQNT
SRSSQKIQDDNLLKYIINLISQSQAKNGEYQVEMQSQIQGDDFFIIPDFDKMHEFIRFFP
KNNYSYVIEQYNKQTVKKQRVIIKRRKRSIKKNTIIQSPGMRKNRSQNRQNTVSNNLQNQ
SFSSIIVNDQQSISYVQNNNQMLNSVDFSNQASEKQSESKFSYYKQPEMPKSSFFKQQQ
Download sequence
Identical sequences 3677.m00021 5911.XP_001032275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]