SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3697.m00047 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3697.m00047
Domain Number 1 Region: 416-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-39
Family cAMP-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 229-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-17
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3697.m00047
Sequence length 1069
Comment cyclic nucleotide-binding domain containing protein
Sequence
MILKSNIAFEDKSSNVSITKIQDHLGSTHKICFPTYNIYEKEDDQSQSRNNKKILFNHND
HSDLEQTKYKKQDSINYDQDFYLSQKSFKDQQFNFAEKQYSELINFKDATFSNDKNYQDQ
KTLIPNGSNDVSIEPTEQKPFDNEKTVRKQRQQRQLEFIQILRNNIGFSNDIWRKRGFGV
LQKLIFFSQRLMSVDIINDRSAFYEIYRYDDYFDKDIFQINRGEGAKSLFVIDVFMNFNT
SFFKQGVINNNRIDIIKRYGKSKFWFDIIIVLPYIFGQNSQFYQSIFILRAFLVTKNHEL
FYVNKYYLISLNRQEISYIDWKKFFTQEIQELLYFYYLSTFETGQTTWVTKLNLEPNDIF
GLYVAGVYYSVITMITLGYGDIVPTTTVERIFVVGMTLVSCAVFAYSVNTKEMVSNESAE
KDLEQIPLSLKEDVYQDIYGKLLRQNKVFNLNFSLEFLDKLALKMKEKRFGPEEIIYREG
DEGNTLYFLIKGNVQLFLPIKGHKDNSYLQIQQLEKGTTFGFYSFFSGNNRETSARSMRV
TSLVTLNLEDFREAAEKFPKDYEKFCMLRDQIKYSNLTKGVLHVITILTNCSNVPFLNTV
KTNKLKKDYKHLLNIILEPEKTILIAKYNKSDPMQRKEQQRRIIRSPNSLFLLQFITKDD
IYCFLNLDGSDSDNDHYHQEQEEAVDLEEQFNDKRTSYANVDDREDYNKIRDNTSQNYKD
NYIKENSSIKEFNSNNNIKDQAYIESQQNKRQSTYHRIESSLSYKRKIMSQHTTASNMAK
QASKLTSRLSFRSQKIQIEKTQNQVIMDFILIDIDKLKSYQNYLPQNNFEKVIQQYNESL
IMQKVYKPKKQLYQIVNKDRQKINLSKLRVIAAFKKVNKNQQIITTKHKIESQSRKKAIL
EQLKQHSEGNSDYLTYESNPNKVNQNNNDIREQKQSPESGKYEIKVLSHSKNSINSEKQP
QNDQENKNEGEIKQNNLLINQSCKSESALDQDILSKSEDVDKIKYKILKKKKTSSFVVKP
SQFYQENQAEEQEFSKDQIEQKRQKSHKKEGRKEGWMDELNQVYPLKKF
Download sequence
Identical sequences 3697.m00047 5911.XP_001016550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]