SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3701.m01484 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3701.m01484
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.41e-36
Family Deoxycytidylate deaminase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3701.m01484
Sequence length 160
Comment conserved hypothetical protein
Sequence
MEQMNDHQYFIQEAIKEAELAVITGDGEPFGCVIVRDGKIIVRAHNRLYIDYDPTAHAET
VAIRLACKQEKSLILKDCIIYASAQPCPMCSTAISACGAKEVYYCVPGTQIQEAFSQITN
FEELGLHPKQFLRREYPCTHIHNDEGLKVINSYFTSKKPK
Download sequence
Identical sequences A4VDC3
3701.m01484 5911.XP_001470903 XP_001470903.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]