SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3721.m00044 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3721.m00044
Domain Number 1 Region: 17-66
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000000391
Family Deoxycytidylate deaminase-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3721.m00044
Sequence length 68
Comment hypothetical protein
Sequence
MQTNQMKKYSLNEDVINYYMKLAIEQSKIATDKLEVAVGCVMVKFTNNNQDHEIVAQSHN
KTNQYGNV
Download sequence
Identical sequences 5911.XP_001022025 3721.m00044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]