SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 84.m00125 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  84.m00125
Domain Number 1 Region: 345-543
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.04e-28
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 230-371
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000345
Family Voltage-gated potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 84.m00125
Sequence length 885
Comment transporter, cation channel family
Sequence
MSIKDLKIEATRYNQGESIKSKDWELVRKKVFEEEDLLWNDSQLKINEAKEKPLNPNQIF
QKLENDMIQNSDEKCLKSMNQSIKSQNTRRRNLFSKKSSSRTGTIELEISNLNEITFLNQ
PQRELLSREQTNLQQGTKQNGSKINKTIESNKQFFKMVSLIAKIKIKMRGFYQNFTNIKR
SRLLSRDIRMIINDQSDGIQTRDNLSNISYFNSQTQEGAEIITERKKAMKIYLKKKLIFD
IIPFTLNMLIFDHTIACLWYLIGHIEIMYFEDDNSWLAQDQYKNEFWWNIYFSALYWSLT
LISTGSNICSANLEIMFTTVIILFSGMSFGYIITIIGDILSEINTKEVKRKQGTNVINNY
MRQTNISKELQAQVNLYLQQYYQNNFFEEQQSNQQVLDKLPADLQDCLKREQFKSLVPQI
DFLFKNLLCIQTIEDLTLFMSEEFYLPNQKLNLNDGQFLLFITQGQLTIFQNDAQEYSRE
KGAKLNVGQHFGLINFITGISSESNAKSSMFTKVVKINRVDFLKVVQKNEVEYQKFCELK
DRIQFYEEFKSLNLKCNICNSFYHLDKSCELININRKQIYYKQKINQQEQQKRIPFKRLN
LKNHNPLIIIQSVNEQAQNFIGDIKKLKETDIIELLDLTISDTEQSQFEERSSQSQLQQS
QEEQELEFESQKYSQNVAHQKIDQGLRKQSTLGRNLPNKQSFKDLDEQQIGFDSIQILKY
DFLSDRPVLNENHITAIKDFEKINKCHSEDKIDIQNFTIQNKKQTFQITQKDIQNQKFKS
PLSSIFENPQENNQKQILQKQFESSFQLLSQIFQSNNNNNNNNNNNNNCNNNNNNINNNY
EFDLQKDFESYFVCGNFKEIQLRLQKQVKKKLKRAHRSFFVPSKN
Download sequence
Identical sequences 84.m00125 5911.XP_001010547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]