SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_126410 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_126410
Domain Number 1 Region: 97-138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.005
Further Details:      
 
Weak hits

Sequence:  Smp_126410
Domain Number - Region: 23-120
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.015
Family Class I alpha-1;2-mannosidase, catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_126410
Sequence length 142
Comment ||29053.m001447|hypothetical protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MPTTFELNWGMSSRMNDVNSSIQWTEDIAKTTDERSIITYVASIYDKLVCNSSKHSLYPI
PIVPPMPSLYHHDQNSTGRSIDSTFQLLTASNQLSDELKSLWSDYRILASDLIQWLRSTT
DRMANRHFPSDLKSMQELTLSD
Download sequence
Identical sequences Smp_126410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]