SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_129030 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_129030
Domain Number 1 Region: 352-494
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0000994
Family Helical scaffold and wing domains of SecA 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_129030
Sequence length 752
Comment ||29062.m001739|Protein FAM44A, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MKNFFEGLGKSRGKNDISGRTSPINLKPSESDEANKDQQTDKKETKSLPSSQKSEESNTR
KNTKDTIEKTNNASDKSREVIKTDEKKTEKQTSPVDTTDKPANKADSNLETPQDKPTSSV
RLIDRVNQGPTTQINEKNPSSTLINFLTSPIQTIKSGRAPSPTTPPTETKPADEVKDLET
NKKSSELKEKQNKNSKDETNEIHSKKVESQSDINVGQKKENISSSQPAPNTKTEELLNKD
KGKIQITKSQDDKVSESQNKSNNIVTKSVSEIPIKKTEKDKPKNESQVSKPEVSQSNTNY
LVPSNIPQPDTYLKLGRNGVITRSEGGQLKPYQPKITSEHHNPPDFSLTSDKGVNRSIAT
GQKEREKYNESQRSDLKNLDPCRPVFFSAIDLKRSGFANAEDIENCWNKLGVPDVENLLK
YLGFPKHGMINLDHLTQALHEALEMNTYDEPSVLAGIRSMNLELHLTDVLKNAYGKEIEK
FDINLTEEREMILRYFHQQLNEIRQKMEILLGQKEVEIKEVQQEHFDHIFAFNEKIKKTV
DQVKSQTEDRNHFQRLKDSIQILRDYSQLLQTTFDNISKQNQKLFNEYEELQQTIQLKEA
TIKTLQEENNQLSENYKNILQKLTSNNINKNNGSNVNTNNMKRIDGTYEINKSNDDKSII
DRKQNNNEYSQPDQNHHQRESPMNPIHMTYPEKNSMSLYHISKEQLAMRQYQNDLEETIR
KQAKQIRQLRSTASKYRPNDPIWTDMIATKDQ
Download sequence
Identical sequences G4V9H3
Smp_129030 XP_018648162.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]