SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_014780.1 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_014780.1
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.68e-41
Family Calponin-homology domain, CH-domain 0.0000358
Further Details:      
 
Domain Number 2 Region: 382-503
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-23
Family Spectrin repeat 0.000045
Further Details:      
 
Domain Number 3 Region: 613-778
Classification Level Classification E-value
Superfamily EF-hand 1.42e-19
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 4 Region: 147-268
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-19
Family Spectrin repeat 0.0000492
Further Details:      
 
Domain Number 5 Region: 262-379
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.0000466
Further Details:      
 
Domain Number 6 Region: 507-618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000327
Family Spectrin repeat 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Smp_014780.1
Sequence length 786
Comment ||29066.t000061, 29066.m001362|alpha-actinin, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MTLGMIWTIILRFAIQDIQIEDSSAKEGLLLWCQRQTAPYKNVCVENFHTSFKDGLAFCA
IIHRNRPHLIDYSQLKKGDHVKNLNLAFEIAEKHLDIPKMLDPEDMASRKNCDEQSVMAY
LSSYYHVFSGSHKTDIAATRIANNLRMIRENQNLEECYETNSTTLLSWINMKLREFGQRD
PQTSVSAVEGLQQKFRLYYRQEKPSKLQEKARLETTYNTLQTRLRLNNKSPYVPANGHLI
TDVAKNWSSLEQADKIYEEWLLEELQRLERLEYLAKKFEVKCSTHEAWTNGKPEALASND
FRSAMLSEMRAFQKKHEAFQSDMTAHHARIEHIQALTEELNKLNHFNINAFNQRCDTIIT
TWDEMRKLSSQREREISKALTALEEIDQLHLDFAKRAAPFNNWMEQTEEDLRDTFIVHTM
PEVERLITAHQAFENTLDEAENESRQLQLCAQKVEEIASEYKLVNATQNPYTNIKPHELP
QRWNMIRELTKKRSTLLNRERERQLANEKLRREFAQKAEAFNSSIETHRAEIVKVSMESH
SSLEDQRNHLQKLEEELNRHQDKLNELEHVNQALEDAYVFENPYTVYSMPTLRVAWEQLF
TLLHYSVNEIDNQILTRDSRGLTAEQMNDLRTCFKHFDKNNTGRLEPNEFKACLVSLGYN
FRDDIKNSLPNLSSGSRGSVCAETDFSRIVNEVDPGHTGYISFDAFLNFMTRDNVDEATE
EQLIQSFKTLGGDKGYITAQDIKERLSAGDAEYCLQNMPVLNGPRGDSGALDYERFAYSI
CGRKPT
Download sequence
Identical sequences G4VBW5
Smp_014780.1 XP_018650013.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]