SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_014780.2 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_014780.2
Domain Number 1 Region: 17-246
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-83
Family Calponin-homology domain, CH-domain 0.0000304
Further Details:      
 
Domain Number 2 Region: 502-623
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-23
Family Spectrin repeat 0.000045
Further Details:      
 
Domain Number 3 Region: 733-898
Classification Level Classification E-value
Superfamily EF-hand 1.79e-19
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 4 Region: 267-388
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-19
Family Spectrin repeat 0.0000492
Further Details:      
 
Domain Number 5 Region: 382-499
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-17
Family Spectrin repeat 0.0000466
Further Details:      
 
Domain Number 6 Region: 627-738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000393
Family Spectrin repeat 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Smp_014780.2
Sequence length 906
Comment ||29066.m001185, 29066.t000061|alpha-actinin, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MAIYDYEGPVDDDDDVESNKDVPIDPAWELQQKKTFTAWCNSHLRNVNKQINVIENDFRD
GVMLIKLLEVISGESLPSPERGMMRFHKIANVNKALDFIQSKGVKLVSIGAEEIVDGNPK
MTLGMIWTIILRFAIQDIQIEDSSAKEGLLLWCQRQTAPYKNVCVENFHTSFKDGLAFCA
IIHRNRPHLIDYSQLKKGDHVKNLNLAFEIAEKHLDIPKMLDPEDMASRKNCDEQSVMAY
LSSYYHVFSGSHKTDIAATRIANNLRMIRENQNLEECYETNSTTLLSWINMKLREFGQRD
PQTSVSAVEGLQQKFRLYYRQEKPSKLQEKARLETTYNTLQTRLRLNNKSPYVPANGHLI
TDVAKNWSSLEQADKIYEEWLLEELQRLERLEYLAKKFEVKCSTHEAWTNGKPEALASND
FRSAMLSEMRAFQKKHEAFQSDMTAHHARIEHIQALTEELNKLNHFNINAFNQRCDTIIT
TWDEMRKLSSQREREISKALTALEEIDQLHLDFAKRAAPFNNWMEQTEEDLRDTFIVHTM
PEVERLITAHQAFENTLDEAENESRQLQLCAQKVEEIASEYKLVNATQNPYTNIKPHELP
QRWNMIRELTKKRSTLLNRERERQLANEKLRREFAQKAEAFNSSIETHRAEIVKVSMESH
SSLEDQRNHLQKLEEELNRHQDKLNELEHVNQALEDAYVFENPYTVYSMPTLRVAWEQLF
TLLHYSVNEIDNQILTRDSRGLTAEQMNDLRTCFKHFDKNNTGRLEPNEFKACLVSLGYN
FRDDIKNSLPNLSSGSRGSVCAETDFSRIVNEVDPGHTGYISFDAFLNFMTRDNVDEATE
EQLIQSFKTLGGDKGYITAQDIKERLSAGDAEYCLQNMPVLNGPRGDSGALDYERFAYSI
CGRKPT
Download sequence
Identical sequences G4VBW4
XP_018650012.1.29077 Smp_014780.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]