SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_027550.1 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_027550.1
Domain Number 1 Region: 552-592,652-786
Classification Level Classification E-value
Superfamily SPOC domain-like 4.71e-40
Family SPOC domain 0.00068
Further Details:      
 
Domain Number 2 Region: 257-409
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.73e-24
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Smp_027550.1
Sequence length 790
Comment ||29098.t000017, 29098.m001060|putative RNA-binding protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MKRQHREDSSSRSKKARAPSISDEEGTNGCINSPKKYKSPPRKALLRRPSREDRSVDKYD
HHGSRQTFLLRPNPAAKFVSSNNSSRSFNPHSEYSSSKKSYVPSSDRLSSHSSKSLVNSS
GRVNPMLAASLASSGKLPNLPIPLGSKRGSSATVAAVAAAAMNAAAMAAALGAGGVISSK
QMSHITKALASATRTGRDRHDSSSHRPPRSSSDRYTGEDSRSSRRKTTSKEKDMLSIFNA
RYARPVEHRNPEDDPNATRTLFLGNLPPDVEEPELRKLFERYGIIEDIDIKRRELETGAT
AFAFVRYLSLDMAHRAKVNLSGQMIGEYRFKIGYGKVIPTRCLWVGGLGPWTNYPEFATL
VNSISAPEKIIWPSGKNYAHILYCDSESAAIAADLLRGYPLGKSHKRIRVDFTDESHMFR
DPNWKRLKRNSSTESSPRHYSPRRSLTPRAKREDSFSDNAYSRNNHYSKYKRDRKTYADS
DRSRSASSSHRRESGHRSRKATHERAPKRSLRDHSLSPEADSTRFVSRSPSSSRSRRYSS
SSSRSPTLETSTNVEQLASCLPSAWDGSFYLKSSSFQCQMHILRGDRSLVDQFMYQGFNS
EASAHSNETRHAGKKSNKDKHTSLDDIDSSESQDDAHGSAKSSCTNKDQVVCLRITQRMR
LDPVKLDDVNQRIQTAGSSGFCILLAVPPHSVSCSEVGDGDKQPQRPLRNLIGYLRAKDS
AGVVLLNPGGQNANDSSSPLTTETTSGVLYAFPPCDFALNLLRESAPQLEKDYGKDDYLA
IILIRGAGVV
Download sequence
Identical sequences G4VIC8
XP_018651785.1.29077 Smp_027550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]