SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_034550 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_034550
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-89
Family Calponin-homology domain, CH-domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 272-394
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-28
Family Spectrin repeat 0.0000116
Further Details:      
 
Domain Number 3 Region: 507-628
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-20
Family Spectrin repeat 0.0000318
Further Details:      
 
Domain Number 4 Region: 389-506
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-19
Family Spectrin repeat 0.0000214
Further Details:      
 
Domain Number 5 Region: 738-891
Classification Level Classification E-value
Superfamily EF-hand 8.01e-18
Family EF-hand modules in multidomain proteins 0.016
Further Details:      
 
Domain Number 6 Region: 634-743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000445
Family Spectrin repeat 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_034550
Sequence length 899
Comment ||29118.m001279, 29118.t000022|alpha-actinin, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MEYGYTVYPDEYFPSVQEEEEEEWDRQAYLDPMWEIQQKKTFTAWCNSYLRKVKCSIENI
EEDFTDGLKLIQLLETLSEEPLPKPDRGKMRFHKLANVNKALDYIESKGVQLVSIGAEEI
VDGNIKMTLGMIWTIILRFCIQDITVEEMSAKEGLLLWCQRKTAPYKNVNVQNFHMSWKD
GLAFCALIHRHRPDLIDYSKLSKDNPIQNLNYAFDVAEKHLDIPRMLDAEDMVNTVRPDE
RSVMTYVSAYYHAFAGAQKAESAANRITKVLKSNQDNEKLMREYEQLASDLLAWIEQQIP
FLKDRTTDGTISGARSKLDHYRGYRGFEKPPRLDEKTLLENTYNTLQTRLRLANRPSFLP
TEGHMIEDIDSAWRQLENYEKGFEDWLVAEIKRLEQIEYLAKKFRLKCLTHEAWADGKAN
ALSLEDYEGASLSTLRALAQKHASFEGDLGAHQNRVERIVAIAEELNQLNYDEVQSVNER
TQNIVEQWDNLGRLSEIRKHKIQGILDLLNQIDQLHLSIAKRIAPFNNWLEQVHEDLQDM
FIVNKVEDVMSLINGHENFKKTLPAAQKELNDIITEAEQVKKLIQSHNLSSELLKNPYTM
IDCSTLQSRWDAMYSLISGRDDALHQELVKQQENDKVNTQFAQLANRFGPYLEHNLETVH
SIVTNQKLSLEDQLQRLNKVEEDLEGWKPTITELEKLHQKQQEFLITHNPHTRYTMETLR
VGWEQLKTNIKRGQNEIENRITANDYRGVTEQQIEECRRCFNHFDKHRTRRLDPLDFRAC
LVSLGFTIPNSSQGEADFMRIMKTVDPHCTGYVTFDAFMQFMSQQTMGADTVEQMVNSFR
TLAGDTPYITTEQLKRELEPELADYCINRMKAYNGPGVANGGALDYTSFAASLYGESEL
Download sequence
Identical sequences G4V935
XP_018648088.1.29077 Smp_034550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]