SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_046130 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_046130
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-26
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 150-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000874
Family LIM domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_046130
Sequence length 646
Comment ||29157.t000061, 29157.m001097|alpha-actinin, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MHQRTMNLNAGHFREMGDDFPQYLLNWCIEQTKTYPHINITDFTSSWKDGLAFCALIHKH
FPDLIDFSHLKSEDALKNLELAFFVAETKLNIPVLTRSQVKVLEDADEKIIFEYVSKLYG
SITRKSSGQLGSDKLPDKNLSYLCEQEEGLPVCGLCGEPVFRVEQLTVFSRNYHRSCYRD
NQLAYLKERNKTLKDSNCSDGPTLTKFSEANSFPTRFSSQKELDTVSNKKRQSTRKPPSR
PPLPDVLSNNASSEMNSVLKTEAKKVADIEHHRNNSDPRHQNIVFYPSALNPFEDDSPHD
VNSQHECTYKPYNPFDDDLSASDSEEINNTSDSDHSNISSISNPPSLVSTPINFRNRYTE
QNNQTFSVEKLVPDESINPRTAHSSIYDLSSLLAYGSLNKAQSSSLSSDAIQSSKSPLDG
SNAKITRSVNTKGPAPPIPVLSRHDIRRDRQSNFIPYTELHKQLYDINNELSNLELSARE
IQTSIREMSENNGSVKRLLKKWLHTVELKDNLFKKESELLQRLRCQELEDRHADLEYELR
TLMAKQDILKTKEEKAREEELISDLLCVVDKRAELSESTGDFEPKHRARSSGRKTIEGKF
KQICLSLRHSSLSQTNLSSIRDKSLKKVRKLKASTISRLKNKTIFR
Download sequence
Identical sequences G4VPT1
XP_018655023.1.29077 Smp_046130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]