SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_123420 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_123420
Domain Number 1 Region: 39-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 131-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000279
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.045
Further Details:      
 
Domain Number 3 Region: 307-410
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000154
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_123420
Sequence length 783
Comment ||29045.m001816, 29045.t000027|aryl hydrocarbon receptor nuclear translocator homolog (darnt),, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MDMVENLTDFSRDSDGGSERDMFEVTSSRLSACKHDGGDHQQDKERYARESHCEIERRRR
NKMTAYINELCEMVPTCSSLARKPDKLTILRMAVSHMKSIRGTGSTTSDGSYKPSFLSDQ
ELKHLVLEAADGFLFVCQCDTGRIIYVSDSVTSVLNQTQSEWYQHTLYELCHPDDAEKIC
EQLTGSILPSQGASILGLTGQASLSTLSNSNSTNLTKQTAGSDLKMGPVASDLSPTSVSD
LVSTHICASQRRNSPANLTNNICSSPVPGRILDLKSDVHIPQCLIALGRLQLVNKPEAVD
LYPHRFNEFLTRHSADTLITFCDQRVQNVLGLETNEVLGQAFGNLLPSSRDKISFQEVFD
KAWKLKGQSFTIMVHMRSKLFTELLFVKCHLTAFVNPYSEEVEYVICTTSSIKAFESETS
GSNPNTTYTENNTYGQTKVDFFERTSHVTHANCSVVRDHINTTPIQPNPKSSTYIHPVNQ
AKESHLSDYWRHTNENTDHFDPGFAIQPSTTEINLPSDLDHQSYPFSGQIDSSLNKPSSL
HSLSCSNTQLIPQSNQEHANIQHHTDPVSGDYLSSIPNNYGTLRNGTDFPTSDVQVLNNF
DHKRNNPLDVNCAFQASNLNTGDCIVQTSESGLTRPSAICFMPSDSVGDCGCDITENMSP
HTMSYLNINRPFGNHETYLPSIDITSDSRTYQQPITDHPTSAFHGWYDPSLPSSSISTSE
SSSIPSDIYHQPVANNHTQDDLSTSDFVYPQPHILQVNNETNNCIQQNPLQQPSYDYFKY
TVQ
Download sequence
Identical sequences Smp_123420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]