SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_123600 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_123600
Domain Number 1 Region: 566-771
Classification Level Classification E-value
Superfamily SPOC domain-like 9.02e-32
Family SPOC domain 0.0013
Further Details:      
 
Domain Number 2 Region: 273-412
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.39e-23
Family Canonical RBD 0.0058
Further Details:      
 
Weak hits

Sequence:  Smp_123600
Domain Number - Region: 18-122
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000163
Family Canonical RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_123600
Sequence length 773
Comment ||29045.t000056, 29045.m001845|putative RNA-binding protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MRRHGDQDFSPPSKRHRDRSGYSERHRSVSRNSPSSRSKYSLSNRHSSRPKNSEGRTHGL
DHSRTICVRNISSKLSADVVEQCVHWELGKYGDLSINVGHLGGERVALVTYQYSEDAQEA
LCDSPIIYILDRPANVTSLIDIANEGDTRKVIASKKRQEGMEAEDINDRRHLMHNIPGKV
ESTFPDFLPKPAPLGPSGTTSLLGMPGMASSAMMAAAAKALGLNAVPGVLPPAQLNTITS
HNRYGSANLRHYEHNRSGFSPGASDSEKESKATRTLFVGSLEPDITEKEVLSAFERYGYV
EQIDIKRSPKPGAHSYAFVRFQNVDMASRAKISMSGRFIRSLHCKIGYGKAIPSHCLYIG
GLESWTSVDSLQRMLSRFGQLTYLDWSPRRKYAIAVYDSCESALEANRQLKSLSATSRPN
LRLRVDFINPELVQPKSQILNKTDSNTEGDGQDNQMSESRNAIIRSDNGIPVTANNCRIR
TNDHFDGGPYTTNQYYIEDPAGDKNLTTVRHLPYVKPPFHISNRYHTYNRNTSRYSDNHG
ILSPVEDIPCNLKSIVTLQELDQYLQPDLWKGKFLLKNNHFYFRCLMLIGNKDISQDLLD
YKDNNSNSEQLTSPTLRISRRGTLDASWMAEATHRIHNVLSTARHNLCLMLILPDTEQTN
KYLHKESKLNNQSNTEITNVKSTINDCFSLHALIAYLKLKQSAGIICPKEEKIQQESLDN
NSEKTTTTQRSSLIVYLFAPSSFALSLLKQAAPCLSSDLATTSDYMILLALRR
Download sequence
Identical sequences Smp_123600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]