SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_123740 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_123740
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-50
Family Calponin-homology domain, CH-domain 0.0000966
Further Details:      
 
Domain Number 2 Region: 990-1098
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000261
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 1139-1253
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000204
Family Spectrin repeat 0.00059
Further Details:      
 
Domain Number 4 Region: 1310-1414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000537
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 227-325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000245
Family Spectrin repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  Smp_123740
Domain Number - Region: 1241-1323
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0304
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_123740
Sequence length 1430
Comment ||29045.t000103, 29045.m001892|Alpha-actinin, sarcomeric (F-actin cross linking protein), putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
TKINHSRMRIHQMENINKALDFLYEEGAHLENVGAQDIVDGNPRITLGLIWTIILHYQAN
IVIKESDETGEVKHARDALLLWCQLKTAEYPQVEIVDFTKSWRDSLAFAALLHRHYPNLI
DYNQICHIDNLQLRLEMIFQQAYLHLGIPILIESKHFIQTCWLEERCVMTIVATWYRYLT
NSHNIKLSLERISKVIQHSLIINHKIFNYIKQVKRWFKWSNINMKQMNQLLCKIQESNEI
RNQLDIKEELQNLLIWRQNEKAEKMSELVQLETLLTEIHTNQLAESRRLFKPPNGYNLSD
LEESWQCLITAEHNCHLAIVDELIRRDQNDSIKPIEFLKEELTENFNQISIQTHHSQSRL
HLLMNELQLKYGINYYNQHYYFIPNQTLYNKLQQIITHLNSMNFNQLTMNDISLMSIIQN
IHLNESKTNETQEYDEYEIIGNLEKCPLIRIYEDIITVLSNMHLSNFSFDHSTSISCQTI
QHEERSIKVIEFIQLLQRQWNKLLIGIKEIHINLIRHKKYLNELYSLITLNTKIEEINLR
IYETYQSVLSISMLADSFEDLIEPVKDKSIQNEVIDMNNEGKQSSIIDKKVITNILGKQK
ALTIDKEIVINSILRQMDHIIEQLKLYTTYLNQLQNEVYIFLPSRSILNDNDYTEFLHLE
TKLNNLSVSRKSCIELTVQSDKQQQHEDSDHSDEISLTGLQTVGSSFQEDIDSIISKSII
DEDTKEQIDQNQLPGIIQLNETLNLQQTNCEIDLVTNESENNLQRLLFTSIKSITSNNIE
DNENDQYTEEHYRTPMNSPEEHELSILLLPNISIIAYHLLNRLNFIQMHYIDYLKDSLNI
RDKLEFQRNILRLIDNIVSMENWIKEKERILLTFNPIIYPSVEFLKSLPTSCPIIITEEI
IHSISQLSIQAYRFKTFEHELISHANLRLSEIEVQEEEDSNEVKDKLDEITIDKGSDQEF
IETDHADKASYLRTSKGVNNEQTDDNNVYTSKYSKLLDYINKKWQHLKLLINSHHDRFEL
AASLSKFHTLCQTTNEWIIHKRELLISTDDLGTDLNSVMQLQRRLLGWEKDFIALQNEIQ
NLNIESERLLKALIEEAPKRRDLYLISGELYATKEVNQLRLNLNHEWELLQVELRNRHDK
LLASAELQQFFQGLDDNQLWLHNIEIRVATHQLAQSVEEAKLEIDIHNELIEQILTRKDE
YNDLINYGRCITAGETDLHYIQLDQRLDRLENGWIELMQMWTYQQKVLQQNLNFQIFLRD
AHSFETLLSTQESKLMNYQLITLQYTTLLDEARTLVDSTKDLIALREDMQQIQTLQEWLI
EKKELAEEYDQASKLSNMSSLVPYKVFVSKQYTQHRILESEIEANNDRIQQVCQHVTNTI
VQYPRIADQLSELLNNFMLLWKSLRKLIQERGDYMVQLHRGMLTSLSLVA
Download sequence
Identical sequences Smp_123740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]