SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_143620 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_143620
Domain Number 1 Region: 149-282,315-423
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-70
Family Calponin-homology domain, CH-domain 0.0000522
Further Details:      
 
Domain Number 2 Region: 970-1091
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000112
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  Smp_143620
Domain Number - Region: 1145-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0112
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 1304-1417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0755
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_143620
Sequence length 1522
Comment ||29137.t000037, 29137.m000872|expressed protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MEPETLNSTYADDYDHNVGDNNSNKNSSRIESGSIIVYNTEILSRSNQQLFSLDLESNTD
NLMKEDSSLKYDETNNIISKHKLNFNLMLSKYSKSIHCKDSNYHQSNSSIHELDTTYGEV
DKSSVLFYNEYDKDDNCNIGINYGTVNDMIIDDISHIIASIKNEQQRVQKKTFTNWVNAC
LQKLPDPIHINDLFKDIGDGTTLIRLLEVLSGEKLQIENPRIIQRAHKLSNVRNALDYLE
KTCKIKLVNINPADVVDGKPAIVLGLIWSIILFYQVNALKSRRKSLSKSIDSDATGNGSS
KSEETSLSEQVDSTKSVTGSRTRQALLTWVEQSFRSHKSTLEIRVTDFGSSWRDGKAFCA
LVHNINPSLIDMGEVMHRKNRENLEFAFNVAEQRLGIPKLLDPEDVDVDKPDERSIITYV
AQFILIASSHPPKIKSRSGSRRSSTNSLEKLQSQQKLKVTDIDIKTESKTENEYHTPLRL
ASYEPDPQIDPALILNASTTANFLERRRARRASLSGPQTMDDEALHNLILATSPVSSETG
GASTPTDDAAVALSSSTPGYTRTTMSGSPSPPSYSTSPHRSGRARSYAGLRLCRVAKNVS
KCRAIANIRVTAEPPRATRHIVPVLHLGGEGNEQTEAEKERILLITIKELIARVRHNPIE
SQDFLTEFESFLQAQLEHENMAAYIRELDDRKRQGLLLGLRPEELERAEAEWSRVKPELD
EWRWRLDNVLPGEWRQVGQWLSKLEKCLITDALIASQLGLELAPEAKNLTHEERATRLQN
CLNEHEDIFNNIEDLNHLIHKLSEENEKLNEIAQNATTSDVLTTLPTRLPQIIVDSLKSR
FITAYLNGQLTKRRLERLVLRWNLTHKITIIREHLINWQTIKCKEKSEVDLHINEIKDYL
SSMNIPEDMANGLNKLKELALERDDIACRIVEQREKLEADAKLPGPMVNQQASVSTGGGA
FILTDYAETERKETNFFLTSLNTRWKDTWSDLLNIQTHLGELSVKWDLYETEKLHLSDWL
IGVRKLLADESTSAEEREKLYNDLKEWRTRVSALNDLGHELMHTCDMTTSSFLDNELKNI
NKNWTEVTTEVIKFVDLDHAEELKNRNSEAMLRLNAFIKSTELLLVSDFVLPETTDLDQA
HAATADYRQQLEEARKQLLEKARTDYLEALKTAEELMTAAKAGQADMEQAEAVMAAVRAA
GEKLDRLANQSVQARLDEVEAATKKAVELALQLAPINDWVQDSEVSVEILNSGSIETNLD
LTNLTTEEAMSKLKGHFTALEEHEKALIEAEKRLNDLKESGLQHIDISQLELATAEARRK
VEAMRTVAKCYETELDRRKSAEQSFSYAIINISDWLDEAERLFQIDTSFDFEEQLPNTEV
IQDKLIANEEFLRKTQTAGQACLIELNRSYDRLVELFSGNEEDLVENSANPMIQPDEVSM
NILLEAANQVTKFRDRFDELMSKATRRQYELKYALLEARLREQLDNTNKILNDEEFRMTS
GEHLASILSDHEIPYRLSIRNN
Download sequence
Identical sequences Smp_143620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]