SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_163360 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_163360
Domain Number 1 Region: 163-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-21
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1108-1256
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-17
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 631-685
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000273
Family Spectrin repeat 0.0095
Further Details:      
 
Weak hits

Sequence:  Smp_163360
Domain Number - Region: 564-665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000101
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 409-467,516-538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1599-1723
Classification Level Classification E-value
Superfamily Spectrin repeat 0.048
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_163360
Sequence length 2862
Comment ||29304.t000040, 29304.m000902|expressed protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MKANAKEINDVLEIFTDHENLYNLCKYLASQKVACSKQTFPDYIPHLERAITILEKLYGN
EIATVVQSAISEFTQNSTVDSEKLLKEYSPSSRTTEYSLLLLGLDTLWILIVAIRAGTGP
STNLVGSISSSGSTITKRSQSISSTGHSAPAALVSTRSPCVDRWLISQDKRLLAWCVAVT
EGYPGISLTNFTHSWRDGLAFLAIAHQIRSELFTFESRLEKTPNQNLSLAFHLATAEFAT
PRLLEPVDMRPENIDARSTAVYLLELRKAVERDRKRRSRGILEIQTAAMIHGQSNEEPNV
IVESRCSPTSTCSTSETSWLDDEIEGDSDDESGDINRLPDPDHFGTVIETTLAWLLAMEE
QFGQNDLQEDQRNFTSNSYTMNKNDQLQSVHNEEDKNFILRLQRANSNETTLMHSAILRN
IDEARDKFETHEDLTAHLSRRQMAVGRCLRLGNRLIKTHENLDNILKNSEVLNQKESNSV
RTGVDAIDGENSESVEEKQRQIIVQQKLRELDPTVIQRQTVLLATRWNNLCRLNTAVGKR
ITASLLRRQTMLLSAIRIQLDKLENEQTLQLNQQIGPSIADIKKQLEANRCLEQLIESGE
ALAERLDNFITIVPQKTTDNEDNYVNDRGVENVIAELATRWSRLVSWVNTRYACLQNVLL
YWRHFEEEANVLSDWLDERTDEVTKTVANLIPSVPNHHSNNILTISHSRHSSFGNDMDLN
EQKLTNYKLLERAGSSGSSVMQTQDSMERITVSKDNLNRDSLQQMVLTQNDAEMEAIDAC
LSPHESRWAQLLASLDRRAQAIREACGDTDSVSRLVEKIVDQLVSRWSQLRDPQINCEDW
PEKDITDIEKYVESTTKKGLLNNIPNNCLRNQQNSQSEAKRLIESGHLTIHKATKISRFD
MQPPPSPTGYRAEFESKAEELLNWLDNSAEILELITMDKRRALETSGQTQVLAGENIEEL
DQLFDEIEERWTYLDKLLIEANRQMRISNQSVEFQQEAAKIHALLTRSKDELLKLKNEDD
LKEIPESKLFTNEMKSQSGNESEIDIANINKRFEDIKLLIVQVKDAISQPITIGHPEDAD
EQLATLNKMVKDFEATSEFLANWEMNSENHLESSPSSSVKWNETLKDLREQYKTVCAELN
MRIDFLQELSEQHELFLNQFEGIEKWLADMADYLDSVSRAHLPSVPVIQAQLQESCEALN
DMKTLKPTLQKVDEVAQRLLEYFSPAYTELTTNRLQSLHNDWNEVRNLTKSNRDHLRAKL
AEANSSTIISRNQEFPGTTILSNLSSSATTLINTHVTCKNDSADRLTANNNTSTANNNNT
PLSTSTTEFSTTDSSTILSSTTTPPTTTISNVVQVDIAKLEVWMQQSKEQLSQFSIINDP
NDLKKLENIIKVISDKIIENRPILAAIDTCNAVSKTGQPILDTEALLTKAHFADLESAVA
AERERLMAAIYHVDDFKTVLNSEKRWFETVKTNNERVKNSNYSEISEITDDLESLDRLSR
EHTIDDEERLNKLANALHESCVMGSAIMKELEVYKTELTLVKVEIDSTTAYLQSLLDQLR
SVDERVVEIETSLLNIEDDLDNYFFNTQSIGDISELTDKLQTRIRDANNLIKDLDEMIEY
KSLRPCTDCLTNRLESYKAQLQERVEPLSKILPQLSNPSVHQSKLNKLNMELKQIENKLC
RLEVISVDPEDIKAAVSSGRTMLATLNELKTDLLNIMDSDESIYTNEKLNNECLSMLSEK
HNQLVLQILSGLERLDKALPLIEELEQLMSQINENLLSVEEVTDYLETADCPVSRKDLIQ
KIYLQLTHLCQENGTVDQIRQVANKLKLLTPADKPELTAELFNEIEDHLHRVVMAKEIFQ
TQMDEVEKDTKCNELLENPMNQLKLRNIHTPEFIDRLTAEVYSNSTTKKSSGDYLLSVNR
LIDNLLKSDAQISSTLQNLAREIRIHFNGIINFNCYCLGTIGQLSLSQTDSCNEDYQYFS
DNMVLETSVSERKTLLQTYFKFTESLFAQQRLYLEARLRDLIVTGGNNNSSDRLEDLLNL
QTLESELQTCNKSLLDSARILQEINDDIKLERKSQINQIQSENSENINVLAQDNDEIVWL
KVLLSTQKNRLDTYKNEFELNKNDWLKRYHLWQSFNERLRDLKMTTDHLLKLQNEGNQIE
LSDIENKIKDTCTEFASLREHSSKLINMNSTRIKAPVKQYSLPSSTGISSIMTSSTFTGA
LDPIATSSTSSNDENQQTKTDIHNNDKPPTVPPRRHSLYRGHSIQSIEHDHEFVRYELNR
LENELLSLCRKYGTLNYVTQPLTVKKTSNTSIYPEKSVNEFNSSQQITNNKLSSENNTNH
NNKNNKSFNQVFSVKEIPVNFENSCTSTETNGKEINDQTVQSDDIKTCLIGLNESIDWFI
HESCLIPVNISEYIDSGKKLDDYFMDDRFWCIKSQTNQSPNSNSTNNKRIEVNNNYVQLK
LKELHDTEWKAMDWRNCIEIFNDKSKVLLKSSTLSDHSAELGKLEATCSKSQTILNYAFN
SLLKYPEILHTFKTDLAKIEGSIRQIELIKNSAEDPDQIIQELSISKWLKMLCQQTKSHK
SKRDGLATNECIKELDPQYGKLGIQLVLLGDLWNSAQNHLSELNQKVYGSMEFTYSASIQ
NYVQDILDEWDNLSNTLQLPSASSEFIPTTTPMTENKILLNHKPILENTVGSQTMKTTNE
SISSSAIITSQMNECYVTKATKTVDTLESPPITSVISNPSETTSTVSTVICHNSISPILN
RMRNEIQQLTRWLTTIRNILETSQAKLGDRFDQDTESQQLQQIKQAIIDGILSEKLVVYH
PATIQLKIKNENHYVDEINNLIGIKILTTEKQKEIRCCGRKT
Download sequence
Identical sequences Smp_163360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]