SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Smp_168650 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_168650
Domain Number 1 Region: 58-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.59e-72
Family Calponin-homology domain, CH-domain 0.000029
Further Details:      
 
Domain Number 2 Region: 2004-2069,2290-2404
Classification Level Classification E-value
Superfamily Plakin repeat 2.29e-17
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 2381-2403,2466-2572
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000575
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 364-479
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 629-739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000811
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 710-845
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000302
Family Spectrin repeat 0.009
Further Details:      
 
Weak hits

Sequence:  Smp_168650
Domain Number - Region: 1892-1973
Classification Level Classification E-value
Superfamily Plakin repeat 0.000175
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1705-1794
Classification Level Classification E-value
Superfamily Plakin repeat 0.00144
Family Plakin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_168650
Sequence length 2783
Comment ||29420.m000179, 29420.t000001|expressed protein|Schistosoma mansoni|chr unknown01||Partial|Auto
Sequence
MSDKIDNLRCLSQPLIHLNGKINSTPVSLPTLSLLNDNSRNRVDFDKVHLSLSVLRLDPA
DRAVIKIADERDAIQKKAFTNWVNQHLVKRNCWVQDLFLDLRNGYLLVRLLECLTNEVLG
LEYIESRVHWIQNIQRVLDFLRYRGIRIVNIRADEIVDGNPKLTLGLIWIIILHFQVSLL
STPIHYCNKLFNFCSFCTKLQSDLRVNLSMDNAAKQTLLSWCRAVTANYPGVYIKDFTES
WKDGRAFLALIHRYRPDLIDFRQVDRQSARENLDLTFDLAERELEVTRLFDSDDIAKTTD
ERSIITYVASIYDKLVCNSSKHSLYPIPIVPPMPSLYHHDQNSTGRSIDSTFQLLTASNQ
LSDELKSLWSDYRILASDLIQWLRSTTDRMANRHFPSDLKSMQERVMDEIRRHRRDERPR
RERERQQLVRMYEELKPSIERGLLPIDLFLRIEQIHRLWDEYDIALQERELAARNEAHRL
DRLQWAGNRALRDCIQVQAQLTALERRVVELKSELPRQHVFDTNNEIRRWRDQLTQIEAK
INGLFSQVQHLRTGRYMQTEQIYRNVCTLHQKFLDLQRLYREFTPSSTVFSSPSVVSSSV
CSTSITMLNHPAFTSLKNGTILENAHLIQGKLISPIEQCLQWIMERFQTVQNASYGTNRK
SVEEATRRHEQFHREVLNFKNEIDRCKSNQQKVIIYFILIVSLLPIRSKEEEQVLNESLQ
ILEQNYQQLMEVSLKRRNMSKSLLEFVERAHNELIWLREHESCEVTRDWTEIYHDELDRI
RIDFQKLMHEIHEKEIVYSELSVLGSSIQLENYDVTDLVQTYLNALERHWAWLLQLTYCF
EAHIEQSSRFQSFFNDVEQCELLLTTSLEELRSLYESTELHTRVIGQESFIFQLVDISQE
IVPPIPSHVDAQDSSTTLIGRRIRVLCSFQPKDYFSDNQSYSGDVSIVNSINTSHLSIAN
TSISSVIEPIFWPIGNSTGYFDKGDFFIILENPENHKLQVRTANGSTLTVPLTCFLPCWP
CSEAIDRAKRIITTLQHFKTCWSELNLRIHGHLLTVTMSQFIDGAPLQYDIPQQIDIRKV
IYRDAERYCLELQLANVPATEVEKFKQHFLDFQNSCIEQMNGVQTIDDKNSIDNEDLLIK
SSELYSIIDELRTVLSTLTVRLRESNSIPLPGRSVDMEVRIRDHKEWSHALARIRAQCTE
LEEHVNDQLQSRSLNEQDTLLSTSLYALHRAASELALTGHEFSCRLADADAWIARLEQTD
QILTDCELCLLGCAVRVHGLLQLDDLNSSTDPDGLRVTVVERAHRDLKSVAERLPQIRSD
LDLLGQQLTRFMVSNGAFNETLHYDTANLCQNSNLIKMHLSPCTDNHYLESNLACSEHRL
AEATKEVEQELKAFGESLVCFSNYQKLSNQLIVWSSEFSSRMRLFGETAQSLGLKSSNTN
MITVQNPSLLKEILKQSDDLLTDLQVNSDVIEQLNKEVAHLISLLTDYAQHTQNYRELVE
RVFQKAGGSRDYQWSPGYGLFDMGKVLQTTDQLNEQFNTHSRRIYDIVNCLNRLLRSEEP
ISMNLSGPIFVKPYRELYIGKWPNELNSRLKETEPSFSPLVSRSKYQENGKDHTLPLKVS
NNSKDKNHSDLSYFNQLIGEKGLKYSVCLNDVRSQPVCLLPTGWEAATLSAISKAHELYG
QKLFPTTGAWFVTNLAGENETYALGETICVGDALRCGLIDLVGHNCHQNRSSLSISWSEA
IECGWLTAYTIQALNRNIKIGDYSASVTDFLTSPSRSPVDRHIDSKTGVVMPYGKKIIDL
YSDGFINDADFHHLASILSSGMCVEFRDCHLTWYEALNISQTDISWKPCLSDWLSAGAYN
PNTRRLRVSLLKSGKGNSKSKSSNNSLVFAENELTIRDAIKNGLLDNTVPEVIVPVENQV
GGNHATSYRRVSLSEAVQIGLVDDVSGYWLGSSSSSSRTKVGVEVAQAAGLLTKAPCLAE
IVLSGLISFTAPNMSEIHPKSNVGILDAHTGQYVLFPEAIKRGLIVGNQPAIILMQSHPN
QVLTLAEALNTNLITPSGFIILENKPMNLWDAVNNNYIRLIYTKSYPPPVGLLLGAKESN
QTHCQHPILQAILTGLIDSSKEEIVLSSTDPHQHGTSSSQQRISLRKSAKHSALCDLHSI
QLLTQGCGLFNEDGHELTGLDALNSGWLKPCNDFQIGSTITYGQITDPINGSSMILSPNM
KAMKNIDISPVGAQLLLGLSINRPSLAYLVNQRFITRLAWLGPGLHNDNLINKTLNDSWF
THSCRSDDILAVIDPISRRKITQSEAIRRHLLDMETGTFRDPVHNQIYPISEAIERGYIL
VKEKSLIGNTASVPYSLHSEVNESIEMVSVKETRLYKILNVLDPRTGTRIDPNEAVKKGL
INLESFTYHGVQPSIPIESAQQLGYISIYGNGYEASHDSLMVDSTDKSSYTLVQLFNNGQ
LVKQSGSKCVIQVPGYTDPMSLNAAIKMGLVNIEHSIVKEFDTEKLYSLDKAISVGLIND
HKGVLLHKNKWIPLTDAINRGLIAEKKLPTEIPTFEEALEKGLIDPASNTFHQSDNTNNS
NQSNSINVHDAIKQGLLKPPATETFLENLNGLPNKGYTHSMDSLLAIKRRSAKDSNYAAD
LRNNTLPPVIPSGHLFSNGNGFIANSGRSESRLIKFLDCHGVGRLRGKSSHCNLRSKPAV
NDGDEYTIRKKPRIKSCDIPKLKERNCVLYAFYYLHDDVRVEASITDTMVREGRVDVHRK
TICDPISGKFYPIPEALTKGFVF
Download sequence
Identical sequences Smp_168650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]