SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000017623 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000017623
Domain Number 1 Region: 23-249
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-50
Family PP-loop ATPase 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000017623
Domain Number - Region: 316-343
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000373
Family a tRNA synthase domain 0.0046
Further Details:      
 
Domain Number - Region: 277-295
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0418
Family Recombination protein RecR 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000017623   Gene: ENSCSAVG00000010373   Transcript: ENSCSAVT00000017815
Sequence length 344
Comment pep:novel reftig:CSAV2.0:reftig_19:3338847:3340205:1 gene:ENSCSAVG00000010373 transcript:ENSCSAVT00000017815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEVCKDKKALLKRPKTGHAVCKECFYWAFETEIHHTILAGKLFSKGEIVAIGASGGKDST
VLAHTLKLLNERYNYGLDLRLLSIDEGITGYRDDSLETVKRNQLEYSLPLTVLSYEDLYG
WTMDAIVRKIGKKNNCTFCGVFRRQALDRGAMMLGVNKIATGHNADDIAETILMNILRGD
IARLKRCTAIITGDDPSGIPRVKPFKYTYEKEIVAYAYFKKLDYFSTECIYSPDAYRGHA
RAYLKDLEAIRPSSIIDIIHSGEMVSVRENVKLPSQLNCKRCGYISSNELCKACILLEGL
NKGKPKLGIGKTSKMDVADIKEEIRKQGEIVRNLKAEKCDKQKV
Download sequence
Identical sequences H2ZJ57
51511.ENSCSAVP00000017623 ENSCSAVP00000017623 ENSCSAVP00000017623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]