SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000774 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000774
Domain Number 1 Region: 63-563
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.65e-147
Family Myeloperoxidase-like 0.000000000137
Further Details:      
 
Domain Number 2 Region: 23-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000238
Family EGF-type module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000774   Gene: ENSCSAVG00000000436   Transcript: ENSCSAVT00000000782
Sequence length 586
Comment pep:novel reftig:CSAV2.0:reftig_5:445212:449821:-1 gene:ENSCSAVG00000000436 transcript:ENSCSAVT00000000782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFSLHIIGFLVFGGILVCESYNPCCSLPCMNSGVCVLVDQNYECDCTATGHYGKNCET
GNKLFRPSRNSLHHLMTHYAWVWKIVNSISWLQKKIMRTVLNVRTKFVQEPSPYVGMSEY
PTWNNYINKSVYARSLPPIPRHCPTPMGIKGPTVLPDIEVLSKLIFQRNNFEPCPMRTNV
FFAFFAQHFTHQFFKTDPKKGIPFQWGDHSVDLSHIYGDTLAREHSLRMHIDGKMKYSTQ
NGEMFPPLTSEANVTMSGERLMKGRKFAIGHPGFAAIPTFFVISTLWLREHNRVCDIMKE
LHSDWDDERIFQTARLILTGETLKIIVEDYVQHVSGFHFQLKYEPEVLHGSDFSYHNQIH
SEFQLLYHWHTLLPDFLKLGDSIYTLKELLFNVEPVVNAGMETVLKQLSEQFAGKVRGRN
QGPELIAVAELSIKQARELRMYPFNKYRERFGLKPYETFEELTGEQKLASVLRDLYHDID
ALEMYVGFFVEHRRYRQVLGETILEIGAPFSLKGVFGNPIGSPAWWKPSTFGGEVGFNII
KTTNLKKFVCRNVKGCPDISFKVPENVKYKSVEKNVEKGAGIADIL
Download sequence
Identical sequences H2Y626
ENSCSAVP00000000774 ENSCSAVP00000000774 51511.ENSCSAVP00000000774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]