SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000010615 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000010615
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-31
Family Skp1 dimerisation domain-like 0.0000075
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily POZ domain 9.16e-23
Family BTB/POZ domain 0.0000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000010615   Gene: ENSCSAVG00000006248   Transcript: ENSCSAVT00000010745
Sequence length 162
Comment pep:known reftig:CSAV2.0:reftig_54:497978:501337:1 gene:ENSCSAVG00000006248 transcript:ENSCSAVT00000010745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTIKLQSHDGETFEVDVEIAKQSITIKTMLEDLGVDEDDEEGVPLPNVNAAILKKVIQW
CTQHKDDAPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPDEIRKTFNIKNDFTEDEEAQVKKENQWCEEK
Download sequence
Identical sequences H2YZ53
ENSCSAVP00000010615 ENSCSAVP00000010615 51511.ENSCSAVP00000010615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]