SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016053 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016053
Domain Number 1 Region: 174-284,405-536
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.02e-56
Family Phosphate binding protein-like 0.00000126
Further Details:      
 
Domain Number 2 Region: 40-148
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000659
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 288-398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000262
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016053   Gene: ENSCSAVG00000009454   Transcript: ENSCSAVT00000016233
Sequence length 592
Comment pep:novel reftig:CSAV2.0:reftig_27:915751:921698:-1 gene:ENSCSAVG00000009454 transcript:ENSCSAVT00000016233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQDQPPDALKNNWAKYVRSFLKSDSSSMFTDQEIDNHSALPATEMTTGVALMLDAVQFY
MISLSRMIKADKYSFYHRSIPCTSSDAWMSGPPLLEKMKSTQIKGLTGTLLFDGDGRRTN
VTFDVLSITYNGLEKIGQWKYDAGGTSLFGIRPNVSKRLTIFERLQQPDIPTSNKSLKNT
TLIEHPYVFKDTNEEDSDYQGYCIDLLNLLAKDLKFSYKMVEVGDTNYGDELEDGTWDGM
IGEVMKGHADMAVAPLTINYVREKVVRFTKPYMSLGVSILFRKPLQGTSNLFRFLNPLSL
LIWVFIIVSYLLVAFIMFCIARFSPREWHSPHSCQPKSPTVVNNFSILNSLWFGFGALMQ
QGTEVSPRSISTRLLAGVWWFFTLIIISSYTANLAAFLTVTRMVSDISSADDLATQTKIK
YGMMREGSTKNFFQNSKIKTYKEMWNYMVQNEENFVTNNQDGMERVLAGDYAYLMESTTL
EYMVSQNCNLTQVGGLLDTIGYGIATMESSLRDELSVSILKLQEGLLDELKLKWWNHAAV
QCPSEDTSNTQSLSVANLGGAFVFLTIGASVAIITAVAEFLAHSLMNAKLKK
Download sequence
Identical sequences H2ZEN7
51511.ENSCSAVP00000016053 ENSCSAVP00000016053 ENSCSAVP00000016053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]