SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016520 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016520
Domain Number 1 Region: 67-581
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.06e-140
Family Myeloperoxidase-like 0.000000000192
Further Details:      
 
Domain Number 2 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000331
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016520   Gene: ENSCSAVG00000009717   Transcript: ENSCSAVT00000016701
Sequence length 602
Comment pep:known reftig:CSAV2.0:reftig_1:1906654:1910956:-1 gene:ENSCSAVG00000009717 transcript:ENSCSAVT00000016701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVSLYTQLDSFLFIFPFAVESVNDPCCSYPCQHQSVCTTSDMISFQCDCTATGYYGVQ
CQLPYLSTRIKSWVKPAKSTSHYLLTHFKPLWWIVNNVTWLRRSMMQFVLKLRVGFVTEP
SPYRGMGSYPSWQAYANDSMYVRTLPPVPLNCPTPMGVKGKPKLPDVDVLVEKFFKRKKF
QPCPQRTSLLFPFFAQHFTHMFFKTDPVKGFPHQWGKQSVDLSNIYGQTLDREHELRSHI
GGKMKTCFINGEEFPPRVNESDATMAKVDSVPKDYQFVHGHQGFGMMPTFLVWTTIWIRE
HNRVCDLIKNENPAWDDERIYQSALNHIYYFQLVYTGELIKIVIEDYVQHLSGFHYKLLY
EPELVQEGHFSFHNQINAEFQLLYHWHPLMPDDVKFNNKTYLMKDLLFNPVPVVKSGMAQ
VIQDLSQQWAGKVAGGSTQGLSTLEVARLAIKDGRTMRMQSLNAYRERFGLKRLKSFEEL
TGEKQMASELKELYGDIDAMEYYVGIMLEKRRIPQLFGETLTEMGSPYSLKGLFANPINH
PAWWKPSTFGGQKVMDVIKGTTLQNLICRTVEGCPRASFTVPSGAIYREEVAGVESDKTS
EI
Download sequence
Identical sequences H2ZG04
ENSCSAVP00000016520 51511.ENSCSAVP00000016520 ENSCSAVP00000016520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]