SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000020121 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000020121
Domain Number 1 Region: 87-510
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.34e-115
Family Pyridoxal-dependent decarboxylase 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000020121   Gene: ENSCSAVG00000011808   Transcript: ENSCSAVT00000020337
Sequence length 562
Comment pep:known reftig:CSAV2.0:reftig_1:6366143:6367831:1 gene:ENSCSAVG00000011808 transcript:ENSCSAVT00000020337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELVGDVLVFLFDVYKSITNWMNNQCSDLQPHEIIFMTLITVCALLYFYNLLFDHDQSFA
VRAKSGFFYHVKRLPIVRSIVAKQMNNVLKEVSAEKLFPLKSGMGYMGQLPEHGRSEGDI
DSMVEEYLTLDEVEWNKGNVSGTVYGGDPQLTDVIARVYKKFAWSNPLHPDVFPALRKME
AEIVRISCNLFHGDPQTSCGCVTVGGTESILLACKTYRDWAYEKGIKKPEMICPVSAHAA
FEKAAHYFKLKLIHIPCDPQTRTADVGAMKRAITSRTCMLVASAPPFPHGVLDPISDIAA
LGVRYGIPVHVDACLGGFLLPFMDDAGFPVAPFDFSVPGVTSISADTHKYGYAPKGSSVV
MYSEKKWIHYQYFVSPDWQGGIYATPMFAGSRSGAIVAACWATLVYFGREGYVERTRKII
STARYIEAGLRKIDSIFVLGKPEMSVVALGSLDFDVFRLSSELVKRGWNLNNLQFPSSIH
ICCTMLHTSPGVADRLLRDVAESVDIIMDNPKAQTTGAGALYGMAQSIPDRSIVTEISQS
FIDALYNTGHHQPLTNGNNYAH
Download sequence
Identical sequences H2ZRA5
51511.ENSCSAVP00000020121 ENSCSAVP00000020121 ENSCSAVP00000020121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]