SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|21435|gm1.4054_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pisti1|21435|gm1.4054_g
Domain Number - Region: 50-85
Classification Level Classification E-value
Superfamily DOPA-like 0.0366
Family DOPA dioxygenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|21435|gm1.4054_g
Sequence length 111
Sequence
MTSVLAFYLSLHESSGQRVVSFKSLDNDIEILVQNNVFPVDSTLCETNVHVKDYHFHIIF
DRRRHRHQRSQASYLFIRIGPHGHPVHIWPENDLDPILDALTLYFNSLLPP
Download sequence
Identical sequences A0A0C3PA80
jgi|Pisti1|21435|gm1.4054_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]