SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|102102|e_gw1.213.5.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|102102|e_gw1.213.5.1
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.1e-52
Family PP-loop ATPase 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|102102|e_gw1.213.5.1
Domain Number - Region: 279-297
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0915
Family Recombination protein RecR 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|102102|e_gw1.213.5.1
Sequence length 327
Sequence
MPVQCAACGKKAILKRPKTADAMCRECFYWAFEEEIHKTIIDAKLFTPGDKVAIGASGGK
DSTVLAYVMKALNDRYNYRLDLYLLSVDEGITGYRDDSLETVKRNRDQYCLPLKIVSYED
LYGWTMDAIVKEIGLKNNCTFCGVFRRQALDRGAMLTECNKIVTGHNADDIAETVIMNIL
RGDIARLRRCTAITTGQEGSLPRCKPFKYTYEKEIVMYAYFKKLDYFSTECIYSPNAYRG
YARAFIKDVEKVRPSAIIDIIHSGESLSIKKDVKMPVQGTCTRCGYVSSQDVCKACLLLE
GLNKGMPKLGIGKPHKVRKVRDIHGYV
Download sequence
Identical sequences R7USV4
jgi|Capca1|102102|e_gw1.213.5.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]