SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|109983|e_gw1.8060.3.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|109983|e_gw1.8060.3.1
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 4.84e-62
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|109983|e_gw1.8060.3.1
Sequence length 238
Sequence
SIRLPRTLLGLIVGGALAVAGASMQGLFRNPLADPSIIGVSSGAALGAGIAIVLGGLLFA
GAPSLIQSYSISILAFAGGVLSTWLVYKVGTTGNGTSVATMLLAGVAINALAGAGMGMLN
YVADDTMLRNLTFWQMGSLGGATWDLVIICATLLVPVILILGRYGLVLNALLLGESEARH
LGIDVQKVKLKLIFLTALAVGVSVSVSGVIGFVGLVVPHLIRLAVGPDHRILLPASAM
Download sequence
Identical sequences R7TEP6
jgi|Capca1|109983|e_gw1.8060.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]