SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|118681|e_gw1.88.87.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|118681|e_gw1.88.87.1
Domain Number 1 Region: 83-192
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000275
Family MgtE N-terminal domain-like 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|118681|e_gw1.88.87.1
Domain Number - Region: 5-110
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000981
Family MgtE N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|118681|e_gw1.88.87.1
Sequence length 210
Sequence
MEDVEDVKSRETADETEDVKAAEIADEMEDVKSTEIADETEDVKSAEIADEMEDVKSTEI
ADEMEDVKSAEIVDEMEDVKSAEIADETEDVKAAEIADEMKDVKPAEIADIFHVKPAEIA
DETEDVKAAEIADEMEDVQSTEIADETEDVKSAEIVDEMEDVKSAEIVDEMVDVKSAEIV
DEMEDGKSAEIADEMVDVKSAEIADEMEDV
Download sequence
Identical sequences R7T5U5
jgi|Capca1|118681|e_gw1.88.87.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]