SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|135173|e_gw1.5676.4.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|135173|e_gw1.5676.4.1
Domain Number 1 Region: 82-149
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 5.62e-19
Family C-terminal domain of arginine repressor 0.00029
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.99e-18
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|135173|e_gw1.5676.4.1
Sequence length 152
Sequence
MTSPKQDALVRSFRQLLKEERCGSQSQIVALLQEQGFDNISQSKVSRMLSRFGAVRARNA
LNELVYCLPPELGKMDSSIAVKDLVEEVDHNESMIVIKTSPGAAQMIARLLDSIGVKGGI
MGCVAGDDTILVVPASIQEIEEITLSISEMFN
Download sequence
Identical sequences R7TM85
jgi|Capca1|135173|e_gw1.5676.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]