SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|179690|estExt_Genewise1Plus.C_2460035 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|179690|estExt_Genewise1Plus.C_2460035
Domain Number 1 Region: 33-170
Classification Level Classification E-value
Superfamily JAB1/MPN domain 3.92e-20
Family JAB1/MPN domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Capca1|179690|estExt_Genewise1Plus.C_2460035
Domain Number - Region: 150-251
Classification Level Classification E-value
Superfamily FliG 0.00314
Family FliG 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|179690|estExt_Genewise1Plus.C_2460035
Sequence length 312
Sequence
MERLLRLGQGGMPGYGQGAPAGDAPVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLML
GEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGF
GCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINPNMMVLGQEPRQTT
SNLGHLNKPSIQALIHGLNRHYYSIAINYRKNELEQKMLLNLHKTSWMGGITLQDYDTHC
KTNQDTVKEMLELAKNYNKALEEEEKMTPEQLAIKNVGKQDPKRHLEEHVDVLMSSNIVQ
CLGAMLHTVAFK
Download sequence
Identical sequences R7ULP6
jgi|Capca1|179690|estExt_Genewise1Plus.C_2460035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]