SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|18025|estExt_fgenesh1_pm.C_5080004 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|18025|estExt_fgenesh1_pm.C_5080004
Domain Number 1 Region: 340-467
Classification Level Classification E-value
Superfamily Plus3-like 4.45e-43
Family Plus3 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|18025|estExt_fgenesh1_pm.C_5080004
Sequence length 694
Sequence
MSKRKKPVALIDSDSDDSDSGADLEEELKALAKKKKSDNNSSSNSNNVPAANNISSSGNN
NANNHESDSDSSSGSDEEWTQGGAKRKKGSTPKGRKSAKKVTSDSEEEASKVHSEPEEGE
VSDSDDGAAPDDSDSATEEFDDGLDENLIRDEDDRRRLDQMTEVEREQELFNRIEKREVL
KTRFTIEQKLRKAKKKEKEKAKRSGGGVGDMGSPLAPKSAANTSLRSQDRRKNMEETRQQ
KDSKKFSALKDLKARREEKRRQAEILSAKEEEERQKRKLKAEDIYSDDDSSGSSDGEDNS
KKHSRRRDTDSDSDQSSHSSGSRSDSDREVSKRVEFVENKEQLAKLRISRHKMERWCHMP
FFDRLVVGCYVRIGIGNHNGRSVYRVAEIIGVVETAKIYQLGTTRTNKGLRLRHAGSERV
YRLEFVSNHDFTETEFLKWRETMMIGGFTLVTVAEIEAKVKEVKDAMTYKYKEEDIDRIV
ESKNRFKKNPHNYAMKKTDLLKQKEMAEISGDTEKLQEVTQILEELEERATELDKRRTSN
ISSVSYINQRNRQRNTVEAEEAMRQEMAEQRSAKADPFTRSQCRPTIVTKSLDPEIDAQI
RQRYQDKYKMEAGAMEFNKEARQKAADLEVAKTAGKPALDNDLFDVHDFEVKIDLEVPSA
SNVSAAKPLDRLLGSSGPRRSLNLADYKKRKGLI
Download sequence
Identical sequences R7U053
jgi|Capca1|18025|estExt_fgenesh1_pm.C_5080004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]