SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|185550|fgenesh1_pg.C_scaffold_27162000001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|185550|fgenesh1_pg.C_scaffold_27162000001
Domain Number 1 Region: 217-373
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 1.57e-60
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.00000402
Further Details:      
 
Domain Number 2 Region: 4-210
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.3e-56
Family Tryptophan biosynthesis enzymes 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|185550|fgenesh1_pg.C_scaffold_27162000001
Sequence length 373
Sequence
MSLLVKICGLTTPETLGAALDAGAEMVGFVFFPPSPRHVGLTAARELGQQAKGRALKVAL
TVDADDATFENIVETLRPDLLQLHGRESVARIRDLKQRFGLPVMKAIAVATTADLVPLAG
YADVCDRILFDARAPKDATRPGGLGATFDWHVLDALALDRPFMVSGGLSADNVAEAVRIT
RAGGVDVSSGVERAPGVKDCDMIRNFIRAARAAEDGPDERGHFGIFGGRFVAETLMPLIL
DLEKAYADAKADPAFQAEMNSYRTHYVGRPSPLYYAERLTQHLGGAKIYFKRDELNHTGS
HKVNNVLGQIMLARRMGKRRIIAETGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPN
VLRMEMLGAKVVP
Download sequence
Identical sequences jgi|Capca1|185550|fgenesh1_pg.C_scaffold_27162000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]